Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
Croatia Croatia France France Hebrew Hebrew Hungary Hungary Vietnamese Vietnamese Greece Greece Czech Republic Czech Republic Denmark Denmark Romania Romania Finland Finland
$0.00
PS4 Slim Skin's Store 8
Star wars Squadron decal skin for PS4 Slim Console and two..
Star wars Squadron decal skin for PS4 Slim Console and two..
$23.00
Star wars Squadron decal skin for PS4 Slim Console and two..
Star wars Squadron decal skin for PS4 Slim Console and two..
$23.00
Star wars Squadron decal skin for PS4 Slim Console and two..
Star wars Squadron decal skin for PS4 Slim Console and two..
$23.00
Star wars squadrons decal skin for PS4 Slim Console and tw..
Star wars squadrons decal skin for PS4 Slim Console and tw..
$23.00
Star wars squadrons decal skin for PS4 Slim Console and tw..
Star wars squadrons decal skin for PS4 Slim Console and tw..
$23.00
Starry decal skin for PS4 Slim Console and two controllers
Starry decal skin for PS4 Slim Console and two controllers
$23.00
Starry Sky decal skin for PS4 Slim Console and two control..
Starry Sky decal skin for PS4 Slim Console and two control..
$23.00
Stealth Air Jordan decal skin for PS4 Slim Console and two..
Stealth Air Jordan decal skin for PS4 Slim Console and two..
$23.00
Stray decal skin for PS4 Slim Console and two controllers
Stray decal skin for PS4 Slim Console and two controllers
$23.00
Stray decal skin for PS4 Slim Console and two controllers
Stray decal skin for PS4 Slim Console and two controllers
$23.00
Stray decal skin for PS4 Slim Console and two controllers
Stray decal skin for PS4 Slim Console and two controllers
$23.00
STRAY decal skin for PS4 Slim Console and two controllers
STRAY decal skin for PS4 Slim Console and two controllers
$23.00
STRAY decal skin for PS4 Slim Console and two controllers
STRAY decal skin for PS4 Slim Console and two controllers
$23.00
Street Fighter 5 decal skin for PS4 Slim Console and two c..
Street Fighter 5 decal skin for PS4 Slim Console and two c..
$23.00
Strike Freedom Gundam decal skin for PS4 Slim Console and ..
Strike Freedom Gundam decal skin for PS4 Slim Console and ..
$23.00
Super Hunting City decal skin for PS4 Slim Console and two..
Super Hunting City decal skin for PS4 Slim Console and two..
$23.00
Super Hunting City decal skin for PS4 Slim Console and two..
Super Hunting City decal skin for PS4 Slim Console and two..
$23.00
Super Hunting City decal skin for PS4 Slim Console and two..
Super Hunting City decal skin for PS4 Slim Console and two..
$23.00
Super Hunting City decal skin for PS4 Slim Console and two..
Super Hunting City decal skin for PS4 Slim Console and two..
$23.00
Super Hunting City decal skin for PS4 Slim Console and two..
Super Hunting City decal skin for PS4 Slim Console and two..
$23.00
Super Hunting City decal skin for PS4 Slim Console and two..
Super Hunting City decal skin for PS4 Slim Console and two..
$23.00
Superman decal skin for PS4 Slim Console and two controllers
Superman decal skin for PS4 Slim Console and two controllers
$23.00
Superman decal skin for PS4 Slim Console and two controllers
Superman decal skin for PS4 Slim Console and two controllers
$23.00
Superman decal skin for PS4 Slim Console and two controllers
Superman decal skin for PS4 Slim Console and two controllers
$23.00
Supreme decal skin for PS4 Slim Console and two controllers
Supreme decal skin for PS4 Slim Console and two controllers
$23.00
Supreme decal skin for PS4 Slim Console and two controllers
Supreme decal skin for PS4 Slim Console and two controllers
$23.00
Supreme decal skin for PS4 Slim Console and two controllers
Supreme decal skin for PS4 Slim Console and two controllers
$23.00
Supreme decal skin for PS4 Slim Console and two controllers
Supreme decal skin for PS4 Slim Console and two controllers
$23.00
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i