Product Added to your Cart
x

-------- OR --------

Default
CroatiaFranceHebrewHungaryVietnameseGreeceCzech RepublicDenmarkRomaniaFinland
USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Menu
0 items
PS4 Slim Skin's Store 8
500 product(s) found for "PS4 Slim Skin's Store 8"
Basketball decal skin for PS..
PS4 Slim Skin's Store 8
Basketball decal skin for PS..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Black ops Cold War decal ski..
PS4 Slim Skin's Store 8
Black ops Cold War decal ski..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Gundam decal skin for PS4 Sl..
PS4 Slim Skin's Store 8
Gundam decal skin for PS4 Sl..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
NieR Automata decal skin for..
PS4 Slim Skin's Store 8
NieR Automata decal skin for..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Fire dragon decal skin for P..
PS4 Slim Skin's Store 8
Fire dragon decal skin for P..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Dog decal skin for PS4 Slim ..
PS4 Slim Skin's Store 8
Dog decal skin for PS4 Slim ..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Attack on Titan decal skin f..
PS4 Slim Skin's Store 8
Attack on Titan decal skin f..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Horse decal skin for PS4 Sli..
PS4 Slim Skin's Store 8
Horse decal skin for PS4 Sli..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Messi decal skin for PS4 Sli..
PS4 Slim Skin's Store 8
Messi decal skin for PS4 Sli..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Messi decal skin for PS4 Sli..
PS4 Slim Skin's Store 8
Messi decal skin for PS4 Sli..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Messi decal skin for PS4 Sli..
PS4 Slim Skin's Store 8
Messi decal skin for PS4 Sli..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
The Lust of us decal skin fo..
PS4 Slim Skin's Store 8
The Lust of us decal skin fo..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Spiderman decal skin for PS4..
PS4 Slim Skin's Store 8
Spiderman decal skin for PS4..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Captain America decal skin f..
PS4 Slim Skin's Store 8
Captain America decal skin f..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Battlefield 2024 decal skin ..
PS4 Slim Skin's Store 8
Battlefield 2024 decal skin ..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Interstellar Travel decal sk..
PS4 Slim Skin's Store 8
Interstellar Travel decal sk..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Naruto decal skin for PS4 Sl..
PS4 Slim Skin's Store 8
Naruto decal skin for PS4 Sl..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Black ops 4 decal skin for P..
PS4 Slim Skin's Store 8
Black ops 4 decal skin for P..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Spider man decal skin for PS..
PS4 Slim Skin's Store 8
Spider man decal skin for PS..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
God of War decal skin for PS..
PS4 Slim Skin's Store 8
God of War decal skin for PS..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Captain America decal skin f..
PS4 Slim Skin's Store 8
Captain America decal skin f..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Dragon Ball decal skin for P..
PS4 Slim Skin's Store 8
Dragon Ball decal skin for P..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Superman decal skin for PS4 ..
PS4 Slim Skin's Store 8
Superman decal skin for PS4 ..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Batman decal skin for PS4 Sl..
PS4 Slim Skin's Store 8
Batman decal skin for PS4 Sl..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Battlefield decal skin for P..
PS4 Slim Skin's Store 8
Battlefield decal skin for P..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Fire Football decal skin for..
PS4 Slim Skin's Store 8
Fire Football decal skin for..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Dragon Ball decal skin for P..
PS4 Slim Skin's Store 8
Dragon Ball decal skin for P..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Dragon Ball decal skin for P..
PS4 Slim Skin's Store 8
Dragon Ball decal skin for P..
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
$23.00
Units in Stock: 999
$23.00
Details
Add To Cart
Latest & Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with PlayStation 4 Slim Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors....
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i