Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
Croatia Croatia France France Hebrew Hebrew Hungary Hungary Vietnamese Vietnamese Greece Greece Czech Republic Czech Republic Denmark Denmark Romania Romania Finland Finland
$0.00
PS4 Slim Skin's Store 9
Kimetsu no Yaiba decal skin for PS4 Slim Console and two c..
Kimetsu no Yaiba decal skin for PS4 Slim Console and two c..
$23.00
Kimetsu no Yaiba decal skin for PS4 Slim Console and two c..
Kimetsu no Yaiba decal skin for PS4 Slim Console and two c..
$23.00
Kimetsu no Yaiba decal skin for PS4 Slim Console and two c..
Kimetsu no Yaiba decal skin for PS4 Slim Console and two c..
$23.00
Kimetsu no Yaiba decal skin for PS4 Slim Console and two c..
Kimetsu no Yaiba decal skin for PS4 Slim Console and two c..
$23.00
Kimetsu no Yaiba decal skin for PS4 Slim Console and two c..
Kimetsu no Yaiba decal skin for PS4 Slim Console and two c..
$23.00
Hogwarts Legacy decal skin for PS4 Slim Console and two co..
Hogwarts Legacy decal skin for PS4 Slim Console and two co..
$23.00
Hell Music decal skin for PS4 Slim Console and two control..
Hell Music decal skin for PS4 Slim Console and two control..
$23.00
Hell Music decal skin for PS4 Slim Console and two control..
Hell Music decal skin for PS4 Slim Console and two control..
$23.00
Hell Music decal skin for PS4 Slim Console and two control..
Hell Music decal skin for PS4 Slim Console and two control..
$23.00
Hell Music decal skin for PS4 Slim Console and two control..
Hell Music decal skin for PS4 Slim Console and two control..
$23.00
GTA 5 decal skin for PS4 Slim Console and two controllers
GTA 5 decal skin for PS4 Slim Console and two controllers
$23.00
God of War Mars decal skin for PS4 Slim Console and two co..
God of War Mars decal skin for PS4 Slim Console and two co..
$23.00
God of War Mars decal skin for PS4 Slim Console and two co..
God of War Mars decal skin for PS4 Slim Console and two co..
$23.00
God of War Mars decal skin for PS4 Slim Console and two co..
God of War Mars decal skin for PS4 Slim Console and two co..
$23.00
Game of Thrones decal skin for PS4 Slim Console and two co..
Game of Thrones decal skin for PS4 Slim Console and two co..
$23.00
Flaming Skull decal skin for PS4 Slim Console and two cont..
Flaming Skull decal skin for PS4 Slim Console and two cont..
$23.00
Final Fantasy 16 decal skin for PS4 Slim Console and two c..
Final Fantasy 16 decal skin for PS4 Slim Console and two c..
$23.00
Fianl Fantasy 16 decal skin for PS4 Slim Console and two c..
Fianl Fantasy 16 decal skin for PS4 Slim Console and two c..
$23.00
Fianl Fantasy 16 decal skin for PS4 Slim Console and two c..
Fianl Fantasy 16 decal skin for PS4 Slim Console and two c..
$23.00
Fianl Fantasy 16 decal skin for PS4 Slim Console and two c..
Fianl Fantasy 16 decal skin for PS4 Slim Console and two c..
$23.00
Fianl Fantasy 16 decal skin for PS4 Slim Console and two c..
Fianl Fantasy 16 decal skin for PS4 Slim Console and two c..
$23.00
Fianl Fantasy 16 decal skin for PS4 Slim Console and two c..
Fianl Fantasy 16 decal skin for PS4 Slim Console and two c..
$23.00
Fianl Fantasy 16 decal skin for PS4 Slim Console and two c..
Fianl Fantasy 16 decal skin for PS4 Slim Console and two c..
$23.00
Fianl Fantasy 16 decal skin for PS4 Slim Console and two c..
Fianl Fantasy 16 decal skin for PS4 Slim Console and two c..
$23.00
Fianl Fantasy 16 decal skin for PS4 Slim Console and two c..
Fianl Fantasy 16 decal skin for PS4 Slim Console and two c..
$23.00
Dragon Ball decal skin for PS4 Slim Console and two contro..
Dragon Ball decal skin for PS4 Slim Console and two contro..
$23.00
Dragon Ball decal skin for PS4 Slim Console and two contro..
Dragon Ball decal skin for PS4 Slim Console and two contro..
$23.00
Dragon Ball decal skin for PS4 Slim Console and two contro..
Dragon Ball decal skin for PS4 Slim Console and two contro..
$23.00
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i