Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
Croatia Croatia France France Hebrew Hebrew Hungary Hungary Vietnamese Vietnamese Greece Greece Czech Republic Czech Republic Denmark Denmark Romania Romania Finland Finland
$0.00
PlayStation 4 Skins
PlayStation 4 Skins
PS4 Skin's Store PS4 Skin's Store 2 PS4 Skin's Store 3 PS4 Skin's Store 4 PS4 Skin's Store 5
Black Panther skin sticker for playstation 4 console and t..
Black Panther skin sticker for playstation 4 console and t..
$22.00
Bioshock Big daddy skin sticker for playstation 4 console ..
Bioshock Big daddy skin sticker for playstation 4 console ..
$22.00
Bioshock Big daddy skin sticker for playstation 4 console ..
Bioshock Big daddy skin sticker for playstation 4 console ..
$22.00
Big Hero 6 skin sticker for playstation 4 console and two ..
Big Hero 6 skin sticker for playstation 4 console and two ..
$22.00
Battlefield I skin sticker for playstation 4 console and t..
Battlefield I skin sticker for playstation 4 console and t..
$22.00
Battlefield I skin sticker for playstation 4 console and t..
Battlefield I skin sticker for playstation 4 console and t..
$22.00
Battlefield Hardline skin sticker for playstation 4 consol..
Battlefield Hardline skin sticker for playstation 4 consol..
$22.00
Batman V Superman skin sticker for playstation 4 console a..
Batman V Superman skin sticker for playstation 4 console a..
$22.00
Baltimore ravens skin sticker for playstation 4 console an..
Baltimore ravens skin sticker for playstation 4 console an..
$22.00
Avengers skin sticker for playstation 4 console and two co..
Avengers skin sticker for playstation 4 console and two co..
$22.00
Avengers infinity war skin sticker for playstation 4 conso..
Avengers infinity war skin sticker for playstation 4 conso..
$22.00
Avengers infinity war skin sticker for playstation 4 conso..
Avengers infinity war skin sticker for playstation 4 conso..
$22.00
Avengers infinity war skin sticker for playstation 4 conso..
Avengers infinity war skin sticker for playstation 4 conso..
$22.00
Avengers infinity war skin sticker for playstation 4 conso..
Avengers infinity war skin sticker for playstation 4 conso..
$22.00
Avengers infinity war skin sticker for playstation 4 conso..
Avengers infinity war skin sticker for playstation 4 conso..
$22.00
Avengers Endgame skin sticker for playstation 4 console an..
Avengers Endgame skin sticker for playstation 4 console an..
$22.00
Avengers Endgame skin sticker for playstation 4 console an..
Avengers Endgame skin sticker for playstation 4 console an..
$22.00
Avengers Age of Ultron skin sticker for playstation 4 cons..
Avengers Age of Ultron skin sticker for playstation 4 cons..
$22.00
Attack on Titan skin sticker for playstation 4 console and..
Attack on Titan skin sticker for playstation 4 console and..
$22.00
Attack on titan skin sticker for playstation 4 console and..
Attack on titan skin sticker for playstation 4 console and..
$22.00
Attack on Titan 2 skin sticker for playstation 4 console a..
Attack on Titan 2 skin sticker for playstation 4 console a..
$22.00
Atelier Ryza skin sticker for playstation 4 console and tw..
Atelier Ryza skin sticker for playstation 4 console and tw..
$22.00
Atelier Ryza skin sticker for playstation 4 console and tw..
Atelier Ryza skin sticker for playstation 4 console and tw..
$22.00
Astronaut with Green grass field and Thunderstrom sky skin..
Astronaut with Green grass field and Thunderstrom sky skin..
$22.00
Assassin's Creed Valhalla skin sticker for playstation 4 c..
Assassin's Creed Valhalla skin sticker for playstation 4 c..
$22.00
Assassin's Creed Valhalla skin sticker for playstation 4 c..
Assassin's Creed Valhalla skin sticker for playstation 4 c..
$22.00
Assassin's Creed skin sticker for playstation 4 console an..
Assassin's Creed skin sticker for playstation 4 console an..
$22.00
Assassins Creed skin sticker for playstation 4 console and..
Assassins Creed skin sticker for playstation 4 console and..
$22.00
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i