Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
Croatia Croatia France France Hebrew Hebrew Hungary Hungary Vietnamese Vietnamese Greece Greece Czech Republic Czech Republic Denmark Denmark Romania Romania Finland Finland
$0.00
PlayStation 4 Skins
PlayStation 4 Skins
PS4 Skin's Store PS4 Skin's Store 2 PS4 Skin's Store 3 PS4 Skin's Store 4 PS4 Skin's Store 5
The Division 2 skin sticker for playstation 4 console and ..
The Division 2 skin sticker for playstation 4 console and ..
$22.00
The Division 2 skin sticker for playstation 4 console and ..
The Division 2 skin sticker for playstation 4 console and ..
$22.00
The Division 2 skin sticker for playstation 4 console and ..
The Division 2 skin sticker for playstation 4 console and ..
$22.00
The chain warden thresh skin sticker for playstation 4 con..
The chain warden thresh skin sticker for playstation 4 con..
$22.00
The 3rd Birthday skin sticker for playstation 4 console an..
The 3rd Birthday skin sticker for playstation 4 console an..
$22.00
Tekken 7 skin sticker for playstation 4 console and two co..
Tekken 7 skin sticker for playstation 4 console and two co..
$22.00
Tekken 7 skin sticker for playstation 4 console and two co..
Tekken 7 skin sticker for playstation 4 console and two co..
$22.00
Tekken 7 skin sticker for playstation 4 console and two co..
Tekken 7 skin sticker for playstation 4 console and two co..
$22.00
Tekken 7 skin sticker for playstation 4 console and two co..
Tekken 7 skin sticker for playstation 4 console and two co..
$22.00
Teenage Mutant Ninja Turtles skin sticker for playstation ..
Teenage Mutant Ninja Turtles skin sticker for playstation ..
$22.00
Tech wallpaper skin sticker for playstation 4 console and ..
Tech wallpaper skin sticker for playstation 4 console and ..
$22.00
Tech wallpaper skin sticker for playstation 4 console and ..
Tech wallpaper skin sticker for playstation 4 console and ..
$22.00
Tech wallpaper skin sticker for playstation 4 console and ..
Tech wallpaper skin sticker for playstation 4 console and ..
$22.00
Tech wallpaper skin sticker for playstation 4 console and ..
Tech wallpaper skin sticker for playstation 4 console and ..
$22.00
Tech wallpaper skin sticker for playstation 4 console and ..
Tech wallpaper skin sticker for playstation 4 console and ..
$22.00
Tech wallpaper skin sticker for playstation 4 console and ..
Tech wallpaper skin sticker for playstation 4 console and ..
$22.00
Tech wallpaper skin sticker for playstation 4 console and ..
Tech wallpaper skin sticker for playstation 4 console and ..
$22.00
Tech wallpaper skin sticker for playstation 4 console and ..
Tech wallpaper skin sticker for playstation 4 console and ..
$22.00
Tartan skin sticker for playstation 4 console and two cont..
Tartan skin sticker for playstation 4 console and two cont..
$22.00
Sword art online skin sticker for playstation 4 console an..
Sword art online skin sticker for playstation 4 console an..
$22.00
Sword Art Online Hollow Fragment skin sticker for playstat..
Sword Art Online Hollow Fragment skin sticker for playstat..
$22.00
Sword Art Online Hollow Fragment skin sticker for playstat..
Sword Art Online Hollow Fragment skin sticker for playstat..
$22.00
Sword Art Online Hollow Fragment skin sticker for playstat..
Sword Art Online Hollow Fragment skin sticker for playstat..
$22.00
Supreme skin sticker for playstation 4 console and two con..
Supreme skin sticker for playstation 4 console and two con..
$22.00
Supergirl skin sticker for playstation 4 console and two c..
Supergirl skin sticker for playstation 4 console and two c..
$22.00
Supergirl skin sticker for playstation 4 console and two c..
Supergirl skin sticker for playstation 4 console and two c..
$22.00
Super Smash Bros Ultimate skin sticker for playstation 4 c..
Super Smash Bros Ultimate skin sticker for playstation 4 c..
$22.00
Super Smash Bros Ultimate skin sticker for playstation 4 c..
Super Smash Bros Ultimate skin sticker for playstation 4 c..
$22.00
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i