Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
Croatia Croatia France France Hebrew Hebrew Hungary Hungary Vietnamese Vietnamese Greece Greece Czech Republic Czech Republic Denmark Denmark Romania Romania Finland Finland
$0.00
PlayStation 4 Skins
PlayStation 4 Skins
PS4 Skin's Store PS4 Skin's Store 2 PS4 Skin's Store 3 PS4 Skin's Store 4 PS4 Skin's Store 5
FIFA 20 skin sticker for playstation 4 console and two con..
FIFA 20 skin sticker for playstation 4 console and two con..
$22.00
FIFA 20 skin sticker for playstation 4 console and two con..
FIFA 20 skin sticker for playstation 4 console and two con..
$22.00
Naruto skin sticker for playstation 4 console and two cont..
Naruto skin sticker for playstation 4 console and two cont..
$22.00
Stranger Things skin sticker for playstation 4 console and..
Stranger Things skin sticker for playstation 4 console and..
$22.00
Stranger Things skin sticker for playstation 4 console and..
Stranger Things skin sticker for playstation 4 console and..
$22.00
Overwatch skin sticker for playstation 4 console and two c..
Overwatch skin sticker for playstation 4 console and two c..
$22.00
Gears 5 skin sticker for playstation 4 console and two con..
Gears 5 skin sticker for playstation 4 console and two con..
$22.00
Gears 5 skin sticker for playstation 4 console and two con..
Gears 5 skin sticker for playstation 4 console and two con..
$22.00
WarFrame skin sticker for playstation 4 console and two co..
WarFrame skin sticker for playstation 4 console and two co..
$22.00
Stranger Things skin sticker for playstation 4 console and..
Stranger Things skin sticker for playstation 4 console and..
$22.00
Rainbow Six Quarantine skin sticker for playstation 4 cons..
Rainbow Six Quarantine skin sticker for playstation 4 cons..
$22.00
Overwatch skin sticker for playstation 4 console and two c..
Overwatch skin sticker for playstation 4 console and two c..
$22.00
WarFrame skin sticker for playstation 4 console and two co..
WarFrame skin sticker for playstation 4 console and two co..
$22.00
Overwatch skin sticker for playstation 4 console and two c..
Overwatch skin sticker for playstation 4 console and two c..
$22.00
Monster Hunter World iceborne skin sticker for playstation..
Monster Hunter World iceborne skin sticker for playstation..
$22.00
Overwatch skin sticker for playstation 4 console and two c..
Overwatch skin sticker for playstation 4 console and two c..
$22.00
Death Stranding skin sticker for playstation 4 console and..
Death Stranding skin sticker for playstation 4 console and..
$22.00
NBA 2K20 skin sticker for playstation 4 console and two co..
NBA 2K20 skin sticker for playstation 4 console and two co..
$22.00
Rainbow Six Quarantine skin sticker for playstation 4 cons..
Rainbow Six Quarantine skin sticker for playstation 4 cons..
$22.00
GhostWire skin sticker for playstation 4 console and two c..
GhostWire skin sticker for playstation 4 console and two c..
$22.00
Call of Duty modern warfare skin sticker for playstation 4..
Call of Duty modern warfare skin sticker for playstation 4..
$22.00
Abstraction skin sticker for playstation 4 console and two..
Abstraction skin sticker for playstation 4 console and two..
$22.00
Abstraction skin sticker for playstation 4 console and two..
Abstraction skin sticker for playstation 4 console and two..
$22.00
Abstraction skin sticker for playstation 4 console and two..
Abstraction skin sticker for playstation 4 console and two..
$22.00
NBA 2K20 skin sticker for playstation 4 console and two co..
NBA 2K20 skin sticker for playstation 4 console and two co..
$22.00
Watch Dogs legion skin sticker for playstation 4 console a..
Watch Dogs legion skin sticker for playstation 4 console a..
$22.00
Borderlands 3 skin sticker for playstation 4 console and t..
Borderlands 3 skin sticker for playstation 4 console and t..
$22.00
Cyberpunk 2077 skin sticker for playstation 4 console and ..
Cyberpunk 2077 skin sticker for playstation 4 console and ..
$22.00
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i