Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
Croatia Croatia France France Hebrew Hebrew Hungary Hungary Vietnamese Vietnamese Greece Greece Czech Republic Czech Republic Denmark Denmark Romania Romania Finland Finland
$0.00
PlayStation 4 Skins
PlayStation 4 Skins
PS4 Skin's Store PS4 Skin's Store 2 PS4 Skin's Store 3 PS4 Skin's Store 4 PS4 Skin's Store 5
Jump Force skin sticker for playstation 4 console and two ..
Jump Force skin sticker for playstation 4 console and two ..
$22.00
Jump Force skin sticker for playstation 4 console and two ..
Jump Force skin sticker for playstation 4 console and two ..
$22.00
Dragon Ball skin sticker for playstation 4 console and two..
Dragon Ball skin sticker for playstation 4 console and two..
$22.00
Apex Legends skin sticker for playstation 4 console and tw..
Apex Legends skin sticker for playstation 4 console and tw..
$22.00
Apex Legends skin sticker for playstation 4 console and tw..
Apex Legends skin sticker for playstation 4 console and tw..
$22.00
Supergirl skin sticker for playstation 4 console and two c..
Supergirl skin sticker for playstation 4 console and two c..
$22.00
ACE Combat 7 skin sticker for playstation 4 console and tw..
ACE Combat 7 skin sticker for playstation 4 console and tw..
$22.00
Yakuza 4 skin sticker for playstation 4 console and two co..
Yakuza 4 skin sticker for playstation 4 console and two co..
$22.00
Supergirl skin sticker for playstation 4 console and two c..
Supergirl skin sticker for playstation 4 console and two c..
$22.00
Yakuza 4 skin sticker for playstation 4 console and two co..
Yakuza 4 skin sticker for playstation 4 console and two co..
$22.00
Anthem skin sticker for playstation 4 console and two cont..
Anthem skin sticker for playstation 4 console and two cont..
$22.00
Rainbow Six Siege skin sticker for playstation 4 console a..
Rainbow Six Siege skin sticker for playstation 4 console a..
$22.00
Kingdom Hearts 3 skin sticker for playstation 4 console an..
Kingdom Hearts 3 skin sticker for playstation 4 console an..
$22.00
AquaMan skin sticker for playstation 4 console and two con..
AquaMan skin sticker for playstation 4 console and two con..
$22.00
Rainbow Six Siege skin sticker for playstation 4 console a..
Rainbow Six Siege skin sticker for playstation 4 console a..
$22.00
Yakuza 4 skin sticker for playstation 4 console and two co..
Yakuza 4 skin sticker for playstation 4 console and two co..
$22.00
ACE Combat 7 skin sticker for playstation 4 console and tw..
ACE Combat 7 skin sticker for playstation 4 console and tw..
$22.00
Darksiders 3 skin sticker for playstation 4 console and tw..
Darksiders 3 skin sticker for playstation 4 console and tw..
$22.00
God Eater 3 skin sticker for playstation 4 console and two..
God Eater 3 skin sticker for playstation 4 console and two..
$22.00
Dragon Quest Builders skin sticker for playstation 4 conso..
Dragon Quest Builders skin sticker for playstation 4 conso..
$22.00
Judge Eyes skin sticker for playstation 4 console and two ..
Judge Eyes skin sticker for playstation 4 console and two ..
$22.00
Onimusha skin sticker for playstation 4 console and two co..
Onimusha skin sticker for playstation 4 console and two co..
$22.00
Dragon Quest Builders skin sticker for playstation 4 conso..
Dragon Quest Builders skin sticker for playstation 4 conso..
$22.00
Just Cause 4 skin sticker for playstation 4 console and tw..
Just Cause 4 skin sticker for playstation 4 console and tw..
$22.00
Fortnite skin sticker for playstation 4 console and two co..
Fortnite skin sticker for playstation 4 console and two co..
$22.00
Judge Eyes skin sticker for playstation 4 console and two ..
Judge Eyes skin sticker for playstation 4 console and two ..
$22.00
God Eater 3 skin sticker for playstation 4 console and two..
God Eater 3 skin sticker for playstation 4 console and two..
$22.00
Just Cause 4 skin sticker for playstation 4 console and tw..
Just Cause 4 skin sticker for playstation 4 console and tw..
$22.00
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i