Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
Croatia Croatia France France Hebrew Hebrew Hungary Hungary Vietnamese Vietnamese Greece Greece Czech Republic Czech Republic Denmark Denmark Romania Romania Finland Finland
$0.00
PlayStation 4 Skins
PlayStation 4 Skins
PS4 Skin's Store PS4 Skin's Store 2 PS4 Skin's Store 3 PS4 Skin's Store 4 PS4 Skin's Store 5
Far Cry 5 skin sticker for playstation 4 console and two c..
Far Cry 5 skin sticker for playstation 4 console and two c..
$22.00
Far Cry 5 skin sticker for playstation 4 console and two c..
Far Cry 5 skin sticker for playstation 4 console and two c..
$22.00
Far Cry 5 skin sticker for playstation 4 console and two c..
Far Cry 5 skin sticker for playstation 4 console and two c..
$22.00
Far Cry 5 skin sticker for playstation 4 console and two c..
Far Cry 5 skin sticker for playstation 4 console and two c..
$22.00
Far Cry 5 skin sticker for playstation 4 console and two c..
Far Cry 5 skin sticker for playstation 4 console and two c..
$22.00
Far Cry New Dawn skin sticker for playstation 4 console an..
Far Cry New Dawn skin sticker for playstation 4 console an..
$22.00
Far Cry New Dawn skin sticker for playstation 4 console an..
Far Cry New Dawn skin sticker for playstation 4 console an..
$22.00
Far Cry New Dawn skin sticker for playstation 4 console an..
Far Cry New Dawn skin sticker for playstation 4 console an..
$22.00
FARCRY 4 skin sticker for playstation 4 console and two co..
FARCRY 4 skin sticker for playstation 4 console and two co..
$22.00
Fear Factory skin sticker for playstation 4 console and tw..
Fear Factory skin sticker for playstation 4 console and tw..
$22.00
FIFA 17 skin sticker for playstation 4 console and two con..
FIFA 17 skin sticker for playstation 4 console and two con..
$22.00
FIFA 19 skin sticker for playstation 4 console and two con..
FIFA 19 skin sticker for playstation 4 console and two con..
$22.00
FIFA 20 skin sticker for playstation 4 console and two con..
FIFA 20 skin sticker for playstation 4 console and two con..
$22.00
FIFA 20 skin sticker for playstation 4 console and two con..
FIFA 20 skin sticker for playstation 4 console and two con..
$22.00
FIFA 20 skin sticker for playstation 4 console and two con..
FIFA 20 skin sticker for playstation 4 console and two con..
$22.00
Final Fantasy 7 skin sticker for playstation 4 console and..
Final Fantasy 7 skin sticker for playstation 4 console and..
$22.00
Final Fantasy skin sticker for playstation 4 console and t..
Final Fantasy skin sticker for playstation 4 console and t..
$22.00
Fire Wolf skin sticker for playstation 4 console and two c..
Fire Wolf skin sticker for playstation 4 console and two c..
$22.00
Floral Pattern skin sticker for playstation 4 console and ..
Floral Pattern skin sticker for playstation 4 console and ..
$22.00
For Honor skin sticker for playstation 4 console and two c..
For Honor skin sticker for playstation 4 console and two c..
$22.00
Fortnite 2 fishing skin sticker for playstation 4 console ..
Fortnite 2 fishing skin sticker for playstation 4 console ..
$22.00
Fortnite battle royale skin sticker for playstation 4 cons..
Fortnite battle royale skin sticker for playstation 4 cons..
$22.00
Fortnite peely skin sticker for playstation 4 console and ..
Fortnite peely skin sticker for playstation 4 console and ..
$22.00
Fortnite Shadoz skin sticker for playstation 4 console and..
Fortnite Shadoz skin sticker for playstation 4 console and..
$22.00
Fortnite skin sticker for playstation 4 console and two co..
Fortnite skin sticker for playstation 4 console and two co..
$22.00
Fortnite skin sticker for playstation 4 console and two co..
Fortnite skin sticker for playstation 4 console and two co..
$22.00
Fortnite skin sticker for playstation 4 console and two co..
Fortnite skin sticker for playstation 4 console and two co..
$22.00
Fortnite skin sticker for playstation 4 console and two co..
Fortnite skin sticker for playstation 4 console and two co..
$22.00
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i