Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
Croatia Croatia France France Hebrew Hebrew Hungary Hungary Vietnamese Vietnamese Greece Greece Czech Republic Czech Republic Denmark Denmark Romania Romania Finland Finland
$0.00
PlayStation 4 Skins
PlayStation 4 Skins
PS4 Skin's Store PS4 Skin's Store 2 PS4 Skin's Store 3 PS4 Skin's Store 4 PS4 Skin's Store 5
Fortnite skin sticker for playstation 4 console and two co..
Fortnite skin sticker for playstation 4 console and two co..
$22.00
Fortnite skin sticker for playstation 4 console and two co..
Fortnite skin sticker for playstation 4 console and two co..
$22.00
Fortnite skin sticker for playstation 4 console and two co..
Fortnite skin sticker for playstation 4 console and two co..
$22.00
Fortnite skin sticker for playstation 4 console and two co..
Fortnite skin sticker for playstation 4 console and two co..
$22.00
Fortnite skin sticker for playstation 4 console and two co..
Fortnite skin sticker for playstation 4 console and two co..
$22.00
Futurama bender skin sticker for playstation 4 console and..
Futurama bender skin sticker for playstation 4 console and..
$22.00
Galaxy Scene skin sticker for playstation 4 console and tw..
Galaxy Scene skin sticker for playstation 4 console and tw..
$22.00
Game of thrones skin sticker for playstation 4 console and..
Game of thrones skin sticker for playstation 4 console and..
$22.00
Game of thrones skin sticker for playstation 4 console and..
Game of thrones skin sticker for playstation 4 console and..
$22.00
Game of thrones skin sticker for playstation 4 console and..
Game of thrones skin sticker for playstation 4 console and..
$22.00
Game of Thrones skin sticker for playstation 4 console and..
Game of Thrones skin sticker for playstation 4 console and..
$22.00
Game of Thrones skin sticker for playstation 4 console and..
Game of Thrones skin sticker for playstation 4 console and..
$22.00
Gears 5 skin sticker for playstation 4 console and two con..
Gears 5 skin sticker for playstation 4 console and two con..
$22.00
Gears 5 skin sticker for playstation 4 console and two con..
Gears 5 skin sticker for playstation 4 console and two con..
$22.00
Gears of War skin sticker for playstation 4 console and tw..
Gears of War skin sticker for playstation 4 console and tw..
$22.00
Ghost of Tsushima skin sticker for playstation 4 console a..
Ghost of Tsushima skin sticker for playstation 4 console a..
$22.00
Ghost of Tsushima skin sticker for playstation 4 console a..
Ghost of Tsushima skin sticker for playstation 4 console a..
$22.00
Ghost Recon breakpoint skin sticker for playstation 4 cons..
Ghost Recon breakpoint skin sticker for playstation 4 cons..
$22.00
Ghost Recon Wild Lands skin sticker for playstation 4 cons..
Ghost Recon Wild Lands skin sticker for playstation 4 cons..
$22.00
Ghost Recon Wild Lands skin sticker for playstation 4 cons..
Ghost Recon Wild Lands skin sticker for playstation 4 cons..
$22.00
Ghost Recon Wild Lands skin sticker for playstation 4 cons..
Ghost Recon Wild Lands skin sticker for playstation 4 cons..
$22.00
Ghost Recon Wild Lands skin sticker for playstation 4 cons..
Ghost Recon Wild Lands skin sticker for playstation 4 cons..
$22.00
GhostWire skin sticker for playstation 4 console and two c..
GhostWire skin sticker for playstation 4 console and two c..
$22.00
God Eater 3 skin sticker for playstation 4 console and two..
God Eater 3 skin sticker for playstation 4 console and two..
$22.00
God Eater 3 skin sticker for playstation 4 console and two..
God Eater 3 skin sticker for playstation 4 console and two..
$22.00
God Eater 3 skin sticker for playstation 4 console and two..
God Eater 3 skin sticker for playstation 4 console and two..
$22.00
God of war 4 skin sticker for playstation 4 console and tw..
God of war 4 skin sticker for playstation 4 console and tw..
$22.00
God of War skin sticker for playstation 4 console and two ..
God of War skin sticker for playstation 4 console and two ..
$22.00
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i