Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
Croatia Croatia France France Hebrew Hebrew Hungary Hungary Vietnamese Vietnamese Greece Greece Czech Republic Czech Republic Denmark Denmark Romania Romania Finland Finland
$0.00
PlayStation 4 Skins
PlayStation 4 Skins
PS4 Skin's Store PS4 Skin's Store 2 PS4 Skin's Store 3 PS4 Skin's Store 4 PS4 Skin's Store 5
Metal Max Xeno skin sticker for playstation 4 console and ..
Metal Max Xeno skin sticker for playstation 4 console and ..
$22.00
Metal Max Xeno skin sticker for playstation 4 console and ..
Metal Max Xeno skin sticker for playstation 4 console and ..
$22.00
Metal Max Xeno skin sticker for playstation 4 console and ..
Metal Max Xeno skin sticker for playstation 4 console and ..
$22.00
Metal Gear Solid V ground zeroes skin sticker for playstat..
Metal Gear Solid V ground zeroes skin sticker for playstat..
$22.00
Metal Gear Solid skin sticker for playstation 4 console an..
Metal Gear Solid skin sticker for playstation 4 console an..
$22.00
Merry Christmas Vault boy skin sticker for playstation 4 c..
Merry Christmas Vault boy skin sticker for playstation 4 c..
$22.00
Merry Christmas skin sticker for playstation 4 console and..
Merry Christmas skin sticker for playstation 4 console and..
$22.00
Mass Effect skin sticker for playstation 4 console and two..
Mass Effect skin sticker for playstation 4 console and two..
$22.00
Marilyn Monroe skin sticker for playstation 4 console and ..
Marilyn Monroe skin sticker for playstation 4 console and ..
$22.00
Luxury Design skin sticker for playstation 4 console and t..
Luxury Design skin sticker for playstation 4 console and t..
$22.00
LocoRoco skin sticker for playstation 4 console and two co..
LocoRoco skin sticker for playstation 4 console and two co..
$22.00
Liverpool FC skin sticker for playstation 4 console and tw..
Liverpool FC skin sticker for playstation 4 console and tw..
$22.00
Liverpool FC skin sticker for playstation 4 console and tw..
Liverpool FC skin sticker for playstation 4 console and tw..
$22.00
Lightning sky skin sticker for playstation 4 console and ..
Lightning sky skin sticker for playstation 4 console and ..
$22.00
Leicester city skin sticker for playstation 4 console and ..
Leicester city skin sticker for playstation 4 console and ..
$22.00
Leicester City Football Club skin sticker for playstation ..
Leicester City Football Club skin sticker for playstation ..
$22.00
LeBron James skin sticker for playstation 4 console and tw..
LeBron James skin sticker for playstation 4 console and tw..
$22.00
Kingdom Hearts 3 skin sticker for playstation 4 console an..
Kingdom Hearts 3 skin sticker for playstation 4 console an..
$22.00
Kingdom Hearts 3 skin sticker for playstation 4 console an..
Kingdom Hearts 3 skin sticker for playstation 4 console an..
$22.00
Kingdom Come Deliverance skin sticker for playstation 4 co..
Kingdom Come Deliverance skin sticker for playstation 4 co..
$22.00
Kevin Durant skin sticker for playstation 4 console and tw..
Kevin Durant skin sticker for playstation 4 console and tw..
$22.00
Kansas city chiefs skin sticker for playstation 4 console ..
Kansas city chiefs skin sticker for playstation 4 console ..
$22.00
Kalista skin sticker for playstation 4 console and two con..
Kalista skin sticker for playstation 4 console and two con..
$22.00
Just Cause 4 skin sticker for playstation 4 console and tw..
Just Cause 4 skin sticker for playstation 4 console and tw..
$22.00
Just Cause 4 skin sticker for playstation 4 console and tw..
Just Cause 4 skin sticker for playstation 4 console and tw..
$22.00
Jump Force skin sticker for playstation 4 console and two ..
Jump Force skin sticker for playstation 4 console and two ..
$22.00
Jump Force skin sticker for playstation 4 console and two ..
Jump Force skin sticker for playstation 4 console and two ..
$22.00
Jump Force skin sticker for playstation 4 console and two ..
Jump Force skin sticker for playstation 4 console and two ..
$22.00
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i