Product Added to your Cart
x

-------- OR --------

Default
CroatiaFranceHebrewHungaryVietnameseGreeceCzech RepublicDenmarkRomaniaFinland
USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Menu
0 items
PS4 Skin's Store
500 product(s) found for "PS4 Skin's Store"
Square block skin sticker fo..
PS4 Skin's Store
Square block skin sticker fo..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Star Wars Battlefront 2 skin..
PS4 Skin's Store
Star Wars Battlefront 2 skin..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Star Wars Kylo Ren skin stic..
PS4 Skin's Store
Star Wars Kylo Ren skin stic..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Star Wars The Last Jedi skin..
PS4 Skin's Store
Star Wars The Last Jedi skin..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Star Wars The Last Jedi skin..
PS4 Skin's Store
Star Wars The Last Jedi skin..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Star Wars The Last Jedi skin..
PS4 Skin's Store
Star Wars The Last Jedi skin..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Stars Wars Jedi fallen orde..
PS4 Skin's Store
Stars Wars Jedi fallen orde..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
State of Decay 2 skin sticke..
PS4 Skin's Store
State of Decay 2 skin sticke..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Stephen Curry skin sticker f..
PS4 Skin's Store
Stephen Curry skin sticker f..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Sticker bomb skin sticker fo..
PS4 Skin's Store
Sticker bomb skin sticker fo..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Stone Wall skin sticker for ..
PS4 Skin's Store
Stone Wall skin sticker for ..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Storm Trooper Special skin s..
PS4 Skin's Store
Storm Trooper Special skin s..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Stranger Things skin sticker..
PS4 Skin's Store
Stranger Things skin sticker..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Street Fight Chun Li skin st..
PS4 Skin's Store
Street Fight Chun Li skin st..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Street Fight Ryu skin sticke..
PS4 Skin's Store
Street Fight Ryu skin sticke..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Street Fighter skin sticker ..
PS4 Skin's Store
Street Fighter skin sticker ..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Super Hunting City skin stic..
PS4 Skin's Store
Super Hunting City skin stic..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Supergirl skin sticker for p..
PS4 Skin's Store
Supergirl skin sticker for p..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Supergirl skin sticker for p..
PS4 Skin's Store
Supergirl skin sticker for p..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Supergirl skin sticker for p..
PS4 Skin's Store
Supergirl skin sticker for p..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Supergirl skin sticker for p..
PS4 Skin's Store
Supergirl skin sticker for p..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Supergirl skin sticker for p..
PS4 Skin's Store
Supergirl skin sticker for p..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Supreme skin sticker for pla..
PS4 Skin's Store
Supreme skin sticker for pla..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Sword Art Online Hollow Frag..
PS4 Skin's Store
Sword Art Online Hollow Frag..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Sword art online skin sticke..
PS4 Skin's Store
Sword art online skin sticke..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Sword Art Online skin sticke..
PS4 Skin's Store
Sword Art Online skin sticke..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Tampa bay buccaneers skin st..
PS4 Skin's Store
Tampa bay buccaneers skin st..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Tech wallpaper skin sticker ..
PS4 Skin's Store
Tech wallpaper skin sticker ..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i