Product Added to your Cart
x

-------- OR --------

Default
CroatiaFranceHebrewHungaryVietnameseGreeceCzech RepublicDenmarkRomaniaFinland
USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Menu
0 items
PS4 Skin's Store 4
500 product(s) found for "PS4 Skin's Store 4"
Vampyr skin sticker for play..
PS4 Skin's Store 4
Vampyr skin sticker for play..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Vampyr skin sticker for play..
PS4 Skin's Store 4
Vampyr skin sticker for play..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Vampyr skin sticker for play..
PS4 Skin's Store 4
Vampyr skin sticker for play..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Valkyria Chronicles 4 skin s..
PS4 Skin's Store 4
Valkyria Chronicles 4 skin s..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Untitled Goose Game skin sti..
PS4 Skin's Store 4
Untitled Goose Game skin sti..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Unravel Two skin sticker for..
PS4 Skin's Store 4
Unravel Two skin sticker for..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Unravel Two skin sticker for..
PS4 Skin's Store 4
Unravel Two skin sticker for..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Unravel Two skin sticker for..
PS4 Skin's Store 4
Unravel Two skin sticker for..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Uncharted The Lost Legacy sk..
PS4 Skin's Store 4
Uncharted The Lost Legacy sk..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Uncharted skin sticker for p..
PS4 Skin's Store 4
Uncharted skin sticker for p..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Uncharted skin sticker for p..
PS4 Skin's Store 4
Uncharted skin sticker for p..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Uncharted skin sticker for p..
PS4 Skin's Store 4
Uncharted skin sticker for p..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
UEFA Euro2016 France skin st..
PS4 Skin's Store 4
UEFA Euro2016 France skin st..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Tristan and Isolde painting ..
PS4 Skin's Store 4
Tristan and Isolde painting ..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Trippy space skin sticker fo..
PS4 Skin's Store 4
Trippy space skin sticker fo..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Transformer Autobots skin st..
PS4 Skin's Store 4
Transformer Autobots skin st..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Traingle wallpaper skin stic..
PS4 Skin's Store 4
Traingle wallpaper skin stic..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Trafficking Muzik skin stick..
PS4 Skin's Store 4
Trafficking Muzik skin stick..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Tomb Raider skin sticker for..
PS4 Skin's Store 4
Tomb Raider skin sticker for..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Tomb Raider skin sticker for..
PS4 Skin's Store 4
Tomb Raider skin sticker for..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Titanfall 2 skin sticker for..
PS4 Skin's Store 4
Titanfall 2 skin sticker for..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Titanfall 2 skin sticker for..
PS4 Skin's Store 4
Titanfall 2 skin sticker for..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Tiger Clipart skin sticker f..
PS4 Skin's Store 4
Tiger Clipart skin sticker f..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
The Witcher Wild Hunt skin s..
PS4 Skin's Store 4
The Witcher Wild Hunt skin s..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
The Witcher Wild Hunt skin s..
PS4 Skin's Store 4
The Witcher Wild Hunt skin s..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
The Witcher Wild Hunt skin s..
PS4 Skin's Store 4
The Witcher Wild Hunt skin s..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
The Predator skin sticker fo..
PS4 Skin's Store 4
The Predator skin sticker fo..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
The Master of Shadows skin s..
PS4 Skin's Store 4
The Master of Shadows skin s..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 4 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i