Product Added to your Cart
x

-------- OR --------

Default
CroatiaFranceHebrewHungaryVietnameseGreeceCzech RepublicDenmarkRomaniaFinland
USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Menu
0 items
PS5 Digital Skin's Store
500 product(s) found for "PS5 Digital Skin's Store"
The Joker decal skin for PS5..
PS5 Digital Skin's Store
The Joker decal skin for PS5..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
The Joker decal skin for PS5..
PS5 Digital Skin's Store
The Joker decal skin for PS5..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
The Joker decal skin for PS5..
PS5 Digital Skin's Store
The Joker decal skin for PS5..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
The Joker decal skin for PS5..
PS5 Digital Skin's Store
The Joker decal skin for PS5..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
The Last of us 2 decal skin ..
PS5 Digital Skin's Store
The Last of us 2 decal skin ..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
The Last of us 2 decal skin ..
PS5 Digital Skin's Store
The Last of us 2 decal skin ..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
The Last of us decal skin fo..
PS5 Digital Skin's Store
The Last of us decal skin fo..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
The Last of us decal skin fo..
PS5 Digital Skin's Store
The Last of us decal skin fo..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
The Last of us decal skin fo..
PS5 Digital Skin's Store
The Last of us decal skin fo..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
The Last of us decal skin fo..
PS5 Digital Skin's Store
The Last of us decal skin fo..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
The Last of US decal skin fo..
PS5 Digital Skin's Store
The Last of US decal skin fo..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
The Mandalorian decal skin f..
PS5 Digital Skin's Store
The Mandalorian decal skin f..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
The Wicher Wild Hunt decal s..
PS5 Digital Skin's Store
The Wicher Wild Hunt decal s..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
The Witcher wild hunt decal ..
PS5 Digital Skin's Store
The Witcher wild hunt decal ..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Tokyo Avengers decal skin fo..
PS5 Digital Skin's Store
Tokyo Avengers decal skin fo..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Tokyo Ghoul decal skin for P..
PS5 Digital Skin's Store
Tokyo Ghoul decal skin for P..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Trabzonspor FT decal skin fo..
PS5 Digital Skin's Store
Trabzonspor FT decal skin fo..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Turkish flag decal skin for ..
PS5 Digital Skin's Store
Turkish flag decal skin for ..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Turkish flag decal skin for ..
PS5 Digital Skin's Store
Turkish flag decal skin for ..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Turkish flag decal skin for ..
PS5 Digital Skin's Store
Turkish flag decal skin for ..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Turkish flag decal skin for ..
PS5 Digital Skin's Store
Turkish flag decal skin for ..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Turning Texture decal skin f..
PS5 Digital Skin's Store
Turning Texture decal skin f..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
UD Las Palmas decal skin for..
PS5 Digital Skin's Store
UD Las Palmas decal skin for..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
US dollars decal skin for PS..
PS5 Digital Skin's Store
US dollars decal skin for PS..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Venom decal skin for PS5 Dig..
PS5 Digital Skin's Store
Venom decal skin for PS5 Dig..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Venom decal skin for PS5 Dig..
PS5 Digital Skin's Store
Venom decal skin for PS5 Dig..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Villarreal FC decal skin for..
PS5 Digital Skin's Store
Villarreal FC decal skin for..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Warring States Warriors 5 de..
PS5 Digital Skin's Store
Warring States Warriors 5 de..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i