Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
Croatia Croatia France France Hebrew Hebrew Hungary Hungary Vietnamese Vietnamese Greece Greece Czech Republic Czech Republic Denmark Denmark Romania Romania Finland Finland
$0.00
PS5 Digital Skin's Store
Spiderman decal skin for PS5 Digital Console and two Contr..
Spiderman decal skin for PS5 Digital Console and two Contr..
$25.00
Spiderman decal skin for PS5 Digital Console and two Contr..
Spiderman decal skin for PS5 Digital Console and two Contr..
$25.00
Spiderman decal skin for PS5 Digital Console and two Contr..
Spiderman decal skin for PS5 Digital Console and two Contr..
$25.00
Spiderman decal skin for PS5 Digital Console and two Contr..
Spiderman decal skin for PS5 Digital Console and two Contr..
$25.00
Spiderman decal skin for PS5 Digital Console and two Contr..
Spiderman decal skin for PS5 Digital Console and two Contr..
$25.00
Spiderman decal skin for PS5 Digital Console and two Contr..
Spiderman decal skin for PS5 Digital Console and two Contr..
$25.00
Spider Man decal skin for PS5 Digital Console and two Cont..
Spider Man decal skin for PS5 Digital Console and two Cont..
$25.00
Spider Man decal skin for PS5 Digital Console and two Cont..
Spider Man decal skin for PS5 Digital Console and two Cont..
$25.00
Special edition decal skin for PS5 Digital Console and two..
Special edition decal skin for PS5 Digital Console and two..
$25.00
Special edition decal skin for PS5 Digital Console and two..
Special edition decal skin for PS5 Digital Console and two..
$25.00
Special edition decal skin for PS5 Digital Console and two..
Special edition decal skin for PS5 Digital Console and two..
$25.00
Special edition decal skin for PS5 Digital Console and two..
Special edition decal skin for PS5 Digital Console and two..
$25.00
Solid Texture decal skin for PS5 Digital Console and two C..
Solid Texture decal skin for PS5 Digital Console and two C..
$25.00
Solid Color decal skin for PS5 Digital Console and two Con..
Solid Color decal skin for PS5 Digital Console and two Con..
$25.00
Solid Color decal skin for PS5 Digital Console and two Con..
Solid Color decal skin for PS5 Digital Console and two Con..
$25.00
Solid Color decal skin for PS5 Digital Console and two Con..
Solid Color decal skin for PS5 Digital Console and two Con..
$25.00
Solid Color decal skin for PS5 Digital Console and two Con..
Solid Color decal skin for PS5 Digital Console and two Con..
$25.00
Solid Color decal skin for PS5 Digital Console and two Con..
Solid Color decal skin for PS5 Digital Console and two Con..
$25.00
Solid Color decal skin for PS5 Digital Console and two Con..
Solid Color decal skin for PS5 Digital Console and two Con..
$25.00
Solid Color decal skin for PS5 Digital Console and two Con..
Solid Color decal skin for PS5 Digital Console and two Con..
$25.00
Solid Black decal skin for PS5 Digital Console and two Con..
Solid Black decal skin for PS5 Digital Console and two Con..
$25.00
Solid Black decal skin for PS5 Digital Console and two Con..
Solid Black decal skin for PS5 Digital Console and two Con..
$25.00
Sky Scene decal skin for PS5 Digital Console and two Contr..
Sky Scene decal skin for PS5 Digital Console and two Contr..
$25.00
Sky Scene decal skin for PS5 Digital Console and two Contr..
Sky Scene decal skin for PS5 Digital Console and two Contr..
$25.00
Skull Horror decal skin for PS5 Digital Console and two Co..
Skull Horror decal skin for PS5 Digital Console and two Co..
$25.00
Sherlock holmes decal skin for PS5 Digital Console and two..
Sherlock holmes decal skin for PS5 Digital Console and two..
$25.00
Sexy Ass decal skin for PS5 Digital Console and two Contro..
Sexy Ass decal skin for PS5 Digital Console and two Contro..
$25.00
Sekiro decal skin for PS5 Digital Console and two Controll..
Sekiro decal skin for PS5 Digital Console and two Controll..
$25.00
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i