Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
Croatia Croatia France France Hebrew Hebrew Hungary Hungary Vietnamese Vietnamese Greece Greece Czech Republic Czech Republic Denmark Denmark Romania Romania Finland Finland
$0.00
PS5 Digital Skin's Store 2
Game of Thrones decal skin for PS5 Digital Console and two..
Game of Thrones decal skin for PS5 Digital Console and two..
$25.00
Game of Thrones decal skin for PS5 Digital Console and two..
Game of Thrones decal skin for PS5 Digital Console and two..
$25.00
Game Fortnite decal skin for PS5 Digital Console and two C..
Game Fortnite decal skin for PS5 Digital Console and two C..
$25.00
Galaxy Scene decal skin for PS5 Digital Console and two Co..
Galaxy Scene decal skin for PS5 Digital Console and two Co..
$25.00
Fortnite decal skin for PS5 Digital Console and two Contro..
Fortnite decal skin for PS5 Digital Console and two Contro..
$25.00
Fortnite decal skin for PS5 Digital Console and two Contro..
Fortnite decal skin for PS5 Digital Console and two Contro..
$25.00
Fortnite decal skin for PS5 Digital Console and two Contro..
Fortnite decal skin for PS5 Digital Console and two Contro..
$25.00
Fortnite decal skin for PS5 Digital Console and two Contro..
Fortnite decal skin for PS5 Digital Console and two Contro..
$25.00
Fortnite decal skin for PS5 Digital Console and two Contro..
Fortnite decal skin for PS5 Digital Console and two Contro..
$25.00
Fortnite decal skin for PS5 Digital Console and two Contro..
Fortnite decal skin for PS5 Digital Console and two Contro..
$25.00
Fortnite decal skin for PS5 Digital Console and two Contro..
Fortnite decal skin for PS5 Digital Console and two Contro..
$25.00
Fortnite decal skin for PS5 Digital Console and two Contro..
Fortnite decal skin for PS5 Digital Console and two Contro..
$25.00
Fortnite decal skin for PS5 Digital Console and two Contro..
Fortnite decal skin for PS5 Digital Console and two Contro..
$25.00
Fortnite decal skin for PS5 Digital Console and two Contro..
Fortnite decal skin for PS5 Digital Console and two Contro..
$25.00
Fortnite decal skin for PS5 Digital Console and two Contro..
Fortnite decal skin for PS5 Digital Console and two Contro..
$25.00
Fortnite decal skin for PS5 Digital Console and two Contro..
Fortnite decal skin for PS5 Digital Console and two Contro..
$25.00
Fortnite decal skin for PS5 Digital Console and two Contro..
Fortnite decal skin for PS5 Digital Console and two Contro..
$25.00
Fortnite decal skin for PS5 Digital Console and two Contro..
Fortnite decal skin for PS5 Digital Console and two Contro..
$25.00
Fortnite decal skin for PS5 Digital Console and two Contro..
Fortnite decal skin for PS5 Digital Console and two Contro..
$25.00
Fortnite Battle Royale decal skin for PS5 Digital Console ..
Fortnite Battle Royale decal skin for PS5 Digital Console ..
$25.00
Formula 1 racing decal skin for PS5 Digital Console and tw..
Formula 1 racing decal skin for PS5 Digital Console and tw..
$25.00
Football decal skin for PS5 Digital Console and two Contro..
Football decal skin for PS5 Digital Console and two Contro..
$25.00
Fluid Texture decal skin for PS5 Digital Console and two C..
Fluid Texture decal skin for PS5 Digital Console and two C..
$25.00
Flower Texture decal skin for PS5 Digital Console and two ..
Flower Texture decal skin for PS5 Digital Console and two ..
$25.00
Floral Texture decal skin for PS5 Digital Console and two ..
Floral Texture decal skin for PS5 Digital Console and two ..
$25.00
Floral Texture decal skin for PS5 Digital Console and two ..
Floral Texture decal skin for PS5 Digital Console and two ..
$25.00
Floor Texture decal skin for PS5 Digital Console and two C..
Floor Texture decal skin for PS5 Digital Console and two C..
$25.00
Final Fantasy decal skin for PS5 Digital Console and two C..
Final Fantasy decal skin for PS5 Digital Console and two C..
$25.00
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i