Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
Croatia Croatia France France Hebrew Hebrew Hungary Hungary Vietnamese Vietnamese Greece Greece Czech Republic Czech Republic Denmark Denmark Romania Romania Finland Finland
$0.00
PS5 Digital Skin's Store 2
Wave Texture decal skin for PS5 Digital Console and two Co..
Wave Texture decal skin for PS5 Digital Console and two Co..
$25.00
Weed decal skin for PS5 Digital Console and two Controllers
Weed decal skin for PS5 Digital Console and two Controllers
$25.00
Weed decal skin for PS5 Digital Console and two Controllers
Weed decal skin for PS5 Digital Console and two Controllers
$25.00
Weed fire decal skin for PS5 Digital Console and two Contr..
Weed fire decal skin for PS5 Digital Console and two Contr..
$25.00
Wolf decal skin for PS5 Digital Console and two Controllers
Wolf decal skin for PS5 Digital Console and two Controllers
$25.00
Wonder Woman decal skin for PS5 Digital Console and two Co..
Wonder Woman decal skin for PS5 Digital Console and two Co..
$25.00
Wood Board decal skin for PS5 Digital Console and two Cont..
Wood Board decal skin for PS5 Digital Console and two Cont..
$25.00
Wood grain decal skin for PS5 Digital Console and two Cont..
Wood grain decal skin for PS5 Digital Console and two Cont..
$25.00
Wood Grain decal skin for PS5 Digital Console and two Cont..
Wood Grain decal skin for PS5 Digital Console and two Cont..
$25.00
Wood Grain decal skin for PS5 Digital Console and two Cont..
Wood Grain decal skin for PS5 Digital Console and two Cont..
$25.00
Wood Grain decal skin for PS5 Digital Console and two Cont..
Wood Grain decal skin for PS5 Digital Console and two Cont..
$25.00
Wood Grain decal skin for PS5 Digital Console and two Cont..
Wood Grain decal skin for PS5 Digital Console and two Cont..
$25.00
Wood Grain decal skin for PS5 Digital Console and two Cont..
Wood Grain decal skin for PS5 Digital Console and two Cont..
$25.00
Wood Grain decal skin for PS5 Digital Console and two Cont..
Wood Grain decal skin for PS5 Digital Console and two Cont..
$25.00
Wood Grain decal skin for PS5 Digital Console and two Cont..
Wood Grain decal skin for PS5 Digital Console and two Cont..
$25.00
Wood Grain decal skin for PS5 Digital Console and two Cont..
Wood Grain decal skin for PS5 Digital Console and two Cont..
$25.00
Wood Grain decal skin for PS5 Digital Console and two Cont..
Wood Grain decal skin for PS5 Digital Console and two Cont..
$25.00
Yakuza decal skin for PS5 Digital Console and two Controll..
Yakuza decal skin for PS5 Digital Console and two Controll..
$25.00
Alien decal skin for PS5 Digital Console and two Controllers
Alien decal skin for PS5 Digital Console and two Controllers
$25.00
Color Texture decal skin for PS5 Digital Console and two C..
Color Texture decal skin for PS5 Digital Console and two C..
$25.00
Dark Souls 3 decal skin for PS5 Digital Console and two Co..
Dark Souls 3 decal skin for PS5 Digital Console and two Co..
$25.00
Demon Slayer skin for PS5 Digital Console and two Controll..
Demon Slayer skin for PS5 Digital Console and two Controll..
$25.00
PES 2021 decal skin for PS5 Digital Console and two Contro..
PES 2021 decal skin for PS5 Digital Console and two Contro..
$25.00
Tekken 7 decal skin for PS5 Digital Console & Controllers
Tekken 7 decal skin for PS5 Digital Console & Controllers
$25.00
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i