Product Added to your Cart
x

-------- OR --------

Default
CroatiaFranceHebrewHungaryVietnameseGreeceCzech RepublicDenmarkRomaniaFinland
USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Menu
0 items
PS5 Digital Skin's Store 2
500 product(s) found for "PS5 Digital Skin's Store 2"
Cube Texture decal skin for ..
PS5 Digital Skin's Store 2
Cube Texture decal skin for ..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Wood grain decal skin for PS..
PS5 Digital Skin's Store 2
Wood grain decal skin for PS..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Hogwarts Legacy decal skin f..
PS5 Digital Skin's Store 2
Hogwarts Legacy decal skin f..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Hogwarts Legacy decal skin f..
PS5 Digital Skin's Store 2
Hogwarts Legacy decal skin f..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Naruto decal skin for PS5 Di..
PS5 Digital Skin's Store 2
Naruto decal skin for PS5 Di..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Kobe Bryant decal skin for P..
PS5 Digital Skin's Store 2
Kobe Bryant decal skin for P..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Venom decal skin for PS5 Dig..
PS5 Digital Skin's Store 2
Venom decal skin for PS5 Dig..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Resident Evil decal skin for..
PS5 Digital Skin's Store 2
Resident Evil decal skin for..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Resident Evil decal skin for..
PS5 Digital Skin's Store 2
Resident Evil decal skin for..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
COD Modern Warfare 2 decal s..
PS5 Digital Skin's Store 2
COD Modern Warfare 2 decal s..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Tom Clancy's The Division de..
PS5 Digital Skin's Store 2
Tom Clancy's The Division de..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Apex Legends decal skin for ..
PS5 Digital Skin's Store 2
Apex Legends decal skin for ..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Final Fantasy decal skin for..
PS5 Digital Skin's Store 2
Final Fantasy decal skin for..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Apex Legends decal skin for ..
PS5 Digital Skin's Store 2
Apex Legends decal skin for ..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Marvel Avengers decal skin f..
PS5 Digital Skin's Store 2
Marvel Avengers decal skin f..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
A Plague Tale decal skin for..
PS5 Digital Skin's Store 2
A Plague Tale decal skin for..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
A Plague Tale decal skin for..
PS5 Digital Skin's Store 2
A Plague Tale decal skin for..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Astro's Playroom decal skin ..
PS5 Digital Skin's Store 2
Astro's Playroom decal skin ..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Astro's Playroom decal skin ..
PS5 Digital Skin's Store 2
Astro's Playroom decal skin ..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
God of War Ragnarok decal sk..
PS5 Digital Skin's Store 2
God of War Ragnarok decal sk..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
God of War Ragnarok decal sk..
PS5 Digital Skin's Store 2
God of War Ragnarok decal sk..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Formula 1 racing decal skin ..
PS5 Digital Skin's Store 2
Formula 1 racing decal skin ..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Arsenal FC decal skin for PS..
PS5 Digital Skin's Store 2
Arsenal FC decal skin for PS..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Digital Texture decal skin f..
PS5 Digital Skin's Store 2
Digital Texture decal skin f..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Digital Texture decal skin f..
PS5 Digital Skin's Store 2
Digital Texture decal skin f..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Digital Texture decal skin f..
PS5 Digital Skin's Store 2
Digital Texture decal skin f..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Digital Texture decal skin f..
PS5 Digital Skin's Store 2
Digital Texture decal skin f..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Digital Texture decal skin f..
PS5 Digital Skin's Store 2
Digital Texture decal skin f..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i