Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
Croatia Croatia France France Hebrew Hebrew Hungary Hungary Vietnamese Vietnamese Greece Greece Czech Republic Czech Republic Denmark Denmark Romania Romania Finland Finland
$0.00
PS5 Disc Skin Sticker
PS5 Disc Skin Sticker
PS5 Disc Skin's Store PS5 Disc Skin's Store 2 PS5 Disc Skin's Store 3 PS5 Disc Skin's Store 4
Naruto decal skin for PS5 Disc Edition Console and two Con..
Naruto decal skin for PS5 Disc Edition Console and two Con..
$23.75
Movie Spiderman decal skin for PS5 Disc Edition Console an..
Movie Spiderman decal skin for PS5 Disc Edition Console an..
$23.75
Mortal Kombat decal skin for PS5 Disc Edition Console and ..
Mortal Kombat decal skin for PS5 Disc Edition Console and ..
$23.75
Monster Hunter Rise decal skin for PS5 Disc Edition Consol..
Monster Hunter Rise decal skin for PS5 Disc Edition Consol..
$23.75
Model Media decal skin for PS5 Disc Edition Console and tw..
Model Media decal skin for PS5 Disc Edition Console and tw..
$23.75
Miami Dolphins decal skin for PS5 Disc Edition Console and..
Miami Dolphins decal skin for PS5 Disc Edition Console and..
$23.75
Louis Vuitton decal skin for PS5 Disc Edition Console and ..
Louis Vuitton decal skin for PS5 Disc Edition Console and ..
$23.75
Little Nightmares 2 decal skin for PS5 Disc Edition Consol..
Little Nightmares 2 decal skin for PS5 Disc Edition Consol..
$23.75
Little Nightmares 2 decal skin for PS5 Disc Edition Consol..
Little Nightmares 2 decal skin for PS5 Disc Edition Consol..
$23.75
Journey of Suzuya decal skin for PS5 Disc Edition Console ..
Journey of Suzuya decal skin for PS5 Disc Edition Console ..
$23.75
Joker decal skin for PS5 Disc Edition Console and two Cont..
Joker decal skin for PS5 Disc Edition Console and two Cont..
$23.75
JoJo's Bizarre Adventure decal skin for PS5 Disc Edition C..
JoJo's Bizarre Adventure decal skin for PS5 Disc Edition C..
$23.75
Humankind decal skin for PS5 Disc Edition Console and two ..
Humankind decal skin for PS5 Disc Edition Console and two ..
$23.75
Hot Anime decal skin for PS5 Disc Edition Console and two ..
Hot Anime decal skin for PS5 Disc Edition Console and two ..
$23.75
Hell's Paradise Jigokuraku decal skin for PS5 Disc Edition..
Hell's Paradise Jigokuraku decal skin for PS5 Disc Edition..
$23.75
Hall of Valor decal skin for PS5 Disc Edition Console and ..
Hall of Valor decal skin for PS5 Disc Edition Console and ..
$23.75
Hall of Valor decal skin for PS5 Disc Edition Console and ..
Hall of Valor decal skin for PS5 Disc Edition Console and ..
$23.75
GTA 5 decal skin for PS5 Disc Edition Console and two Cont..
GTA 5 decal skin for PS5 Disc Edition Console and two Cont..
$23.75
Grim Reaper decal skin for PS5 Disc Edition Console and tw..
Grim Reaper decal skin for PS5 Disc Edition Console and tw..
$23.75
God of War 5 decal skin for PS5 Disc Edition Console and t..
God of War 5 decal skin for PS5 Disc Edition Console and t..
$23.75
Gintama decal skin for PS5 Disc Edition Console and two Co..
Gintama decal skin for PS5 Disc Edition Console and two Co..
$23.75
Ghost Rider decal skin for PS5 Disc Edition Console and tw..
Ghost Rider decal skin for PS5 Disc Edition Console and tw..
$23.75
Game Mario decal skin for PS5 Disc Edition Console and two..
Game Mario decal skin for PS5 Disc Edition Console and two..
$23.75
Galatasaray SK decal skin for PS5 Disc Edition Console and..
Galatasaray SK decal skin for PS5 Disc Edition Console and..
$23.75
Galatasaray SK decal skin for PS5 Disc Edition Console and..
Galatasaray SK decal skin for PS5 Disc Edition Console and..
$23.75
Galatasaray SK decal skin for PS5 Disc Edition Console and..
Galatasaray SK decal skin for PS5 Disc Edition Console and..
$23.75
Fortnite decal skin for PS5 Disc Edition Console and two C..
Fortnite decal skin for PS5 Disc Edition Console and two C..
$23.75
Formula 1 Racing decal skin for PS5 Disc Edition Console a..
Formula 1 Racing decal skin for PS5 Disc Edition Console a..
$23.75
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i