Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
Croatia Croatia France France Hebrew Hebrew Hungary Hungary Vietnamese Vietnamese Greece Greece Czech Republic Czech Republic Denmark Denmark Romania Romania Finland Finland
$0.00
PS5 Disc Skin Sticker
PS5 Disc Skin Sticker
PS5 Disc Skin's Store PS5 Disc Skin's Store 2 PS5 Disc Skin's Store 3 PS5 Disc Skin's Store 4
Louis Vuitton decal skin for PS5 Disc Edition Console and ..
Louis Vuitton decal skin for PS5 Disc Edition Console and ..
$23.75
Miami Dolphins decal skin for PS5 Disc Edition Console and..
Miami Dolphins decal skin for PS5 Disc Edition Console and..
$23.75
Model Media decal skin for PS5 Disc Edition Console and tw..
Model Media decal skin for PS5 Disc Edition Console and tw..
$23.75
Monster Hunter Rise decal skin for PS5 Disc Edition Consol..
Monster Hunter Rise decal skin for PS5 Disc Edition Consol..
$23.75
Mortal Kombat decal skin for PS5 Disc Edition Console and ..
Mortal Kombat decal skin for PS5 Disc Edition Console and ..
$23.75
Movie Spiderman decal skin for PS5 Disc Edition Console an..
Movie Spiderman decal skin for PS5 Disc Edition Console an..
$23.75
Naruto decal skin for PS5 Disc Edition Console and two Con..
Naruto decal skin for PS5 Disc Edition Console and two Con..
$23.75
Naruto decal skin for PS5 Disc Edition Console and two Con..
Naruto decal skin for PS5 Disc Edition Console and two Con..
$23.75
NBA 2K23 decal skin for PS5 Disc Edition Console and two C..
NBA 2K23 decal skin for PS5 Disc Edition Console and two C..
$23.75
On The Broken Projectile decal skin for PS5 Disc Edition C..
On The Broken Projectile decal skin for PS5 Disc Edition C..
$23.75
Overlord The Undead King decal skin for PS5 Disc Edition C..
Overlord The Undead King decal skin for PS5 Disc Edition C..
$23.75
Paris Saint Germain FC decal skin for PS5 Disc Edition Con..
Paris Saint Germain FC decal skin for PS5 Disc Edition Con..
$23.75
Paris Saint-Germain FC decal skin for PS5 Disc Edition Con..
Paris Saint-Germain FC decal skin for PS5 Disc Edition Con..
$23.75
Pittsburgh Steelers decal skin for PS5 Disc Edition Consol..
Pittsburgh Steelers decal skin for PS5 Disc Edition Consol..
$23.75
Rose Flower decal skin for PS5 Disc Edition Console and tw..
Rose Flower decal skin for PS5 Disc Edition Console and tw..
$23.75
SCARLET NEXUS decal skin for PS5 Disc Edition Console and ..
SCARLET NEXUS decal skin for PS5 Disc Edition Console and ..
$23.75
Sekiro Shadows Die Twice decal skin for PS5 Disc Edition C..
Sekiro Shadows Die Twice decal skin for PS5 Disc Edition C..
$23.75
Skull Flame decal skin for PS5 Disc Edition Console and tw..
Skull Flame decal skin for PS5 Disc Edition Console and tw..
$23.75
Smoky Skull decal skin for PS5 Disc Edition Console and tw..
Smoky Skull decal skin for PS5 Disc Edition Console and tw..
$23.75
Solid Color Yellow decal skin for PS5 Disc Edition Console..
Solid Color Yellow decal skin for PS5 Disc Edition Console..
$23.75
Special Edition decal skin for PS5 Disc Edition Console an..
Special Edition decal skin for PS5 Disc Edition Console an..
$23.75
Spiderman decal skin for PS5 Disc Edition Console and two ..
Spiderman decal skin for PS5 Disc Edition Console and two ..
$23.75
Starry Sky decal skin for PS5 Disc Edition Console and two..
Starry Sky decal skin for PS5 Disc Edition Console and two..
$23.75
Starry Sky decal skin for PS5 Disc Edition Console and two..
Starry Sky decal skin for PS5 Disc Edition Console and two..
$23.75
Starry Sky decal skin for PS5 Disc Edition Console and two..
Starry Sky decal skin for PS5 Disc Edition Console and two..
$23.75
Starry Sky decal skin for PS5 Disc Edition Console and two..
Starry Sky decal skin for PS5 Disc Edition Console and two..
$23.75
Stranger Things decal skin for PS5 Disc Edition Console an..
Stranger Things decal skin for PS5 Disc Edition Console an..
$23.75
Super Mario decal skin for PS5 Disc Edition Console and tw..
Super Mario decal skin for PS5 Disc Edition Console and tw..
$23.75
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i