Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
Croatia Croatia France France Hebrew Hebrew Hungary Hungary Vietnamese Vietnamese Greece Greece Czech Republic Czech Republic Denmark Denmark Romania Romania Finland Finland
$0.00
PS5 Disc Skin Sticker
PS5 Disc Skin Sticker
PS5 Disc Skin's Store PS5 Disc Skin's Store 2 PS5 Disc Skin's Store 3 PS5 Disc Skin's Store 4
Starry Sky decal skin for PS5 Disc Edition Console and two..
Starry Sky decal skin for PS5 Disc Edition Console and two..
$23.75
Gintama decal skin for PS5 Disc Edition Console and two Co..
Gintama decal skin for PS5 Disc Edition Console and two Co..
$23.75
Black Panther decal skin for PS5 Disc Edition Console and ..
Black Panther decal skin for PS5 Disc Edition Console and ..
$23.75
Camouflage Texture decal skin for PS5 Disc Edition Console..
Camouflage Texture decal skin for PS5 Disc Edition Console..
$23.75
Stranger Things decal skin for PS5 Disc Edition Console an..
Stranger Things decal skin for PS5 Disc Edition Console an..
$23.75
Ghost Rider decal skin for PS5 Disc Edition Console and tw..
Ghost Rider decal skin for PS5 Disc Edition Console and tw..
$23.75
Dragon Tattoo decal skin for PS5 Disc Edition Console and ..
Dragon Tattoo decal skin for PS5 Disc Edition Console and ..
$23.75
Model Media decal skin for PS5 Disc Edition Console and tw..
Model Media decal skin for PS5 Disc Edition Console and tw..
$23.75
GTA 5 decal skin for PS5 Disc Edition Console and two Cont..
GTA 5 decal skin for PS5 Disc Edition Console and two Cont..
$23.75
Venom decal skin for PS5 Disc Edition Console and two Cont..
Venom decal skin for PS5 Disc Edition Console and two Cont..
$23.75
Overlord The Undead King decal skin for PS5 Disc Edition C..
Overlord The Undead King decal skin for PS5 Disc Edition C..
$23.75
Arsenal Football Club decal skin for PS5 Disc Edition Cons..
Arsenal Football Club decal skin for PS5 Disc Edition Cons..
$23.75
Unisex Style decal skin for PS5 Disc Edition Console and t..
Unisex Style decal skin for PS5 Disc Edition Console and t..
$23.75
Formula 1 Racing decal skin for PS5 Disc Edition Console a..
Formula 1 Racing decal skin for PS5 Disc Edition Console a..
$23.75
Astro's Playroom decal skin for PS5 Disc Edition Console a..
Astro's Playroom decal skin for PS5 Disc Edition Console a..
$23.75
Astro's Playroom decal skin for PS5 Disc Edition Console a..
Astro's Playroom decal skin for PS5 Disc Edition Console a..
$23.75
Astro's Playroom decal skin for PS5 Disc Edition Console a..
Astro's Playroom decal skin for PS5 Disc Edition Console a..
$23.75
Fortnite decal skin for PS5 Disc Edition Console and two C..
Fortnite decal skin for PS5 Disc Edition Console and two C..
$23.75
Naruto decal skin for PS5 Disc Edition Console and two Con..
Naruto decal skin for PS5 Disc Edition Console and two Con..
$23.75
Camouflage decal skin for PS5 Disc Edition Console and two..
Camouflage decal skin for PS5 Disc Edition Console and two..
$23.75
Arsenal Football Club decal skin for PS5 Disc Edition Cons..
Arsenal Football Club decal skin for PS5 Disc Edition Cons..
$23.75
Blackpink decal skin for PS5 Disc Edition Console and two ..
Blackpink decal skin for PS5 Disc Edition Console and two ..
$23.75
Journey of Suzuya decal skin for PS5 Disc Edition Console ..
Journey of Suzuya decal skin for PS5 Disc Edition Console ..
$23.75
Joker decal skin for PS5 Disc Edition Console and two Cont..
Joker decal skin for PS5 Disc Edition Console and two Cont..
$23.75
The Last of Us decal skin for PS5 Disc Edition Console and..
The Last of Us decal skin for PS5 Disc Edition Console and..
$23.75
Anime Cute Girl decal skin for PS5 Disc Edition Console an..
Anime Cute Girl decal skin for PS5 Disc Edition Console an..
$23.75
Hell's Paradise Jigokuraku decal skin for PS5 Disc Edition..
Hell's Paradise Jigokuraku decal skin for PS5 Disc Edition..
$23.75
Mortal Kombat decal skin for PS5 Disc Edition Console and ..
Mortal Kombat decal skin for PS5 Disc Edition Console and ..
$23.75
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i