Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
Croatia Croatia France France Hebrew Hebrew Hungary Hungary Vietnamese Vietnamese Greece Greece Czech Republic Czech Republic Denmark Denmark Romania Romania Finland Finland
$0.00
PS5 Disc Skin Sticker
PS5 Disc Skin Sticker
PS5 Disc Skin's Store PS5 Disc Skin's Store 2 PS5 Disc Skin's Store 3 PS5 Disc Skin's Store 4
Crash Bandicoot decal skin for PS5 Disc Edition Console an..
Crash Bandicoot decal skin for PS5 Disc Edition Console an..
$23.75
Sekiro Shadows Die Twice decal skin for PS5 Disc Edition C..
Sekiro Shadows Die Twice decal skin for PS5 Disc Edition C..
$23.75
Rose Flower decal skin for PS5 Disc Edition Console and tw..
Rose Flower decal skin for PS5 Disc Edition Console and tw..
$23.75
Skull Flame decal skin for PS5 Disc Edition Console and tw..
Skull Flame decal skin for PS5 Disc Edition Console and tw..
$23.75
Naruto decal skin for PS5 Disc Edition Console and two Con..
Naruto decal skin for PS5 Disc Edition Console and two Con..
$23.75
Paris Saint Germain FC decal skin for PS5 Disc Edition Con..
Paris Saint Germain FC decal skin for PS5 Disc Edition Con..
$23.75
Game Mario decal skin for PS5 Disc Edition Console and two..
Game Mario decal skin for PS5 Disc Edition Console and two..
$23.75
Borderlands decal skin for PS5 Disc Edition Console and tw..
Borderlands decal skin for PS5 Disc Edition Console and tw..
$23.75
On The Broken Projectile decal skin for PS5 Disc Edition C..
On The Broken Projectile decal skin for PS5 Disc Edition C..
$23.75
Besiktas Jimnastik Klubu decal skin for PS5 Disc Edition C..
Besiktas Jimnastik Klubu decal skin for PS5 Disc Edition C..
$23.75
Special Edition decal skin for PS5 Disc Edition Console an..
Special Edition decal skin for PS5 Disc Edition Console an..
$23.75
Monster Hunter Rise decal skin for PS5 Disc Edition Consol..
Monster Hunter Rise decal skin for PS5 Disc Edition Consol..
$23.75
Super Mario decal skin for PS5 Disc Edition Console and tw..
Super Mario decal skin for PS5 Disc Edition Console and tw..
$23.75
JoJo's Bizarre Adventure decal skin for PS5 Disc Edition C..
JoJo's Bizarre Adventure decal skin for PS5 Disc Edition C..
$23.75
Grim Reaper decal skin for PS5 Disc Edition Console and tw..
Grim Reaper decal skin for PS5 Disc Edition Console and tw..
$23.75
Galatasaray SK decal skin for PS5 Disc Edition Console and..
Galatasaray SK decal skin for PS5 Disc Edition Console and..
$23.75
Galatasaray SK decal skin for PS5 Disc Edition Console and..
Galatasaray SK decal skin for PS5 Disc Edition Console and..
$23.75
Galatasaray SK decal skin for PS5 Disc Edition Console and..
Galatasaray SK decal skin for PS5 Disc Edition Console and..
$23.75
Anime Naruto decal skin for PS5 Disc Edition Console and t..
Anime Naruto decal skin for PS5 Disc Edition Console and t..
$23.75
Starry Sky decal skin for PS5 Disc Edition Console and two..
Starry Sky decal skin for PS5 Disc Edition Console and two..
$23.75
Detroit Become Human decal skin for PS5 Disc Edition Conso..
Detroit Become Human decal skin for PS5 Disc Edition Conso..
$23.75
The Punisher decal skin for PS5 Disc Edition Console and t..
The Punisher decal skin for PS5 Disc Edition Console and t..
$23.75
Movie Spiderman decal skin for PS5 Disc Edition Console an..
Movie Spiderman decal skin for PS5 Disc Edition Console an..
$23.75
Hall of Valor decal skin for PS5 Disc Edition Console and ..
Hall of Valor decal skin for PS5 Disc Edition Console and ..
$23.75
Hall of Valor decal skin for PS5 Disc Edition Console and ..
Hall of Valor decal skin for PS5 Disc Edition Console and ..
$23.75
Louis Vuitton decal skin for PS5 Disc Edition Console and ..
Louis Vuitton decal skin for PS5 Disc Edition Console and ..
$23.75
Devil May Cry 5 decal skin for PS5 Disc Edition Console an..
Devil May Cry 5 decal skin for PS5 Disc Edition Console an..
$23.75
Weed Leaf decal skin for PS5 Disc Edition Console and two ..
Weed Leaf decal skin for PS5 Disc Edition Console and two ..
$23.75
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i