Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
Croatia Croatia France France Hebrew Hebrew Hungary Hungary Vietnamese Vietnamese Greece Greece Czech Republic Czech Republic Denmark Denmark Romania Romania Finland Finland
$0.00
PS5 Disc Skin Sticker
PS5 Disc Skin Sticker
PS5 Disc Skin's Store PS5 Disc Skin's Store 2 PS5 Disc Skin's Store 3 PS5 Disc Skin's Store 4
The Last of Us decal skin for PS5 Disc Edition Console and..
The Last of Us decal skin for PS5 Disc Edition Console and..
$23.75
The Last of Us decal skin for PS5 Disc Edition Console and..
The Last of Us decal skin for PS5 Disc Edition Console and..
$23.75
The Punisher decal skin for PS5 Disc Edition Console and t..
The Punisher decal skin for PS5 Disc Edition Console and t..
$23.75
Tv Series Game of Thrones decal skin for PS5 Disc Edition ..
Tv Series Game of Thrones decal skin for PS5 Disc Edition ..
$23.75
Unisex Style decal skin for PS5 Disc Edition Console and t..
Unisex Style decal skin for PS5 Disc Edition Console and t..
$23.75
Venom decal skin for PS5 Disc Edition Console and two Cont..
Venom decal skin for PS5 Disc Edition Console and two Cont..
$23.75
Weed Leaf decal skin for PS5 Disc Edition Console and two ..
Weed Leaf decal skin for PS5 Disc Edition Console and two ..
$23.75
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i