Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
Croatia Croatia France France Hebrew Hebrew Hungary Hungary Vietnamese Vietnamese Greece Greece Czech Republic Czech Republic Denmark Denmark Romania Romania Finland Finland
$0.00
PS5 Disc Skin Sticker
PS5 Disc Skin Sticker
PS5 Disc Skin's Store PS5 Disc Skin's Store 2 PS5 Disc Skin's Store 3 PS5 Disc Skin's Store 4
Al Hilal SFC decal skin for PS5 Disc Edition Console and t..
Al Hilal SFC decal skin for PS5 Disc Edition Console and t..
$23.75
Smoky Skull decal skin for PS5 Disc Edition Console and tw..
Smoky Skull decal skin for PS5 Disc Edition Console and tw..
$23.75
Little Nightmares 2 decal skin for PS5 Disc Edition Consol..
Little Nightmares 2 decal skin for PS5 Disc Edition Consol..
$23.75
Little Nightmares 2 decal skin for PS5 Disc Edition Consol..
Little Nightmares 2 decal skin for PS5 Disc Edition Consol..
$23.75
Humankind decal skin for PS5 Disc Edition Console and two ..
Humankind decal skin for PS5 Disc Edition Console and two ..
$23.75
Starry Sky decal skin for PS5 Disc Edition Console and two..
Starry Sky decal skin for PS5 Disc Edition Console and two..
$23.75
Tv Series Game of Thrones decal skin for PS5 Disc Edition ..
Tv Series Game of Thrones decal skin for PS5 Disc Edition ..
$23.75
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i