Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
Croatia Croatia France France Hebrew Hebrew Hungary Hungary Vietnamese Vietnamese Greece Greece Czech Republic Czech Republic Denmark Denmark Romania Romania Finland Finland
$0.00
PS5 Disc Skin's Store
Jordan NBA decal skin for PS5 Disc Edition Console and two..
Jordan NBA decal skin for PS5 Disc Edition Console and two..
$25.00
Journey of Suzuya decal skin for PS5 Disc Edition Console ..
Journey of Suzuya decal skin for PS5 Disc Edition Console ..
$25.00
Journey of Suzuya decal skin for PS5 Disc Edition Console ..
Journey of Suzuya decal skin for PS5 Disc Edition Console ..
$25.00
Journey of Suzuya decal skin for PS5 Disc Edition Console ..
Journey of Suzuya decal skin for PS5 Disc Edition Console ..
$25.00
Jujutsu Kaisen decal skin for PS5 Disc Edition Console and..
Jujutsu Kaisen decal skin for PS5 Disc Edition Console and..
$25.00
Jujutsu Kaisen decal skin for PS5 Disc Edition Console and..
Jujutsu Kaisen decal skin for PS5 Disc Edition Console and..
$25.00
Jujutsu Kaisen decal skin for PS5 Disc Edition Console and..
Jujutsu Kaisen decal skin for PS5 Disc Edition Console and..
$25.00
Jujutsu Kaisen decal skin for PS5 Disc Edition Console and..
Jujutsu Kaisen decal skin for PS5 Disc Edition Console and..
$25.00
Jump Force decal skin for PS5 Disc Edition Console and two..
Jump Force decal skin for PS5 Disc Edition Console and two..
$25.00
Jump Force decal skin for PS5 Disc Edition Console and two..
Jump Force decal skin for PS5 Disc Edition Console and two..
$25.00
Jump Force decal skin for PS5 Disc Edition Console and two..
Jump Force decal skin for PS5 Disc Edition Console and two..
$25.00
Jump Naruto One Piece decal skin for PS5 Disc Edition Cons..
Jump Naruto One Piece decal skin for PS5 Disc Edition Cons..
$25.00
Kaws decal skin for PS5 Disc Edition Console and two Contr..
Kaws decal skin for PS5 Disc Edition Console and two Contr..
$25.00
Kimetsu No Yaiba decal skin for PS5 Disc Edition Console a..
Kimetsu No Yaiba decal skin for PS5 Disc Edition Console a..
$25.00
Kimetsu No Yaiba decal skin for PS5 Disc Edition Console a..
Kimetsu No Yaiba decal skin for PS5 Disc Edition Console a..
$25.00
Kimetsu No Yaiba decal skin for PS5 Disc Edition Console a..
Kimetsu No Yaiba decal skin for PS5 Disc Edition Console a..
$25.00
Kimetsu No Yaiba decal skin for PS5 Disc Edition Console a..
Kimetsu No Yaiba decal skin for PS5 Disc Edition Console a..
$25.00
Kimetsu No Yaiba decal skin for PS5 Disc Edition Console a..
Kimetsu No Yaiba decal skin for PS5 Disc Edition Console a..
$25.00
Kimetsu No Yaiba decal skin for PS5 Disc Edition Console a..
Kimetsu No Yaiba decal skin for PS5 Disc Edition Console a..
$25.00
Kimetsu No Yaiba decal skin for PS5 Disc Edition Console a..
Kimetsu No Yaiba decal skin for PS5 Disc Edition Console a..
$25.00
Kimetsu No Yaiba decal skin for PS5 Disc Edition Console a..
Kimetsu No Yaiba decal skin for PS5 Disc Edition Console a..
$25.00
Kimetsu No Yaiba decal skin for PS5 Disc Edition Console a..
Kimetsu No Yaiba decal skin for PS5 Disc Edition Console a..
$25.00
Kimetsu No Yaiba decal skin for PS5 Disc Edition Console a..
Kimetsu No Yaiba decal skin for PS5 Disc Edition Console a..
$25.00
Kingdom Hearts decal skin for PS5 Disc Edition Console and..
Kingdom Hearts decal skin for PS5 Disc Edition Console and..
$25.00
Kingdom Hearts decal skin for PS5 Disc Edition Console and..
Kingdom Hearts decal skin for PS5 Disc Edition Console and..
$25.00
Kingdom Hearts decal skin for PS5 Disc Edition Console and..
Kingdom Hearts decal skin for PS5 Disc Edition Console and..
$25.00
Kobe Bryant decal skin for PS5 Disc Edition Console and tw..
Kobe Bryant decal skin for PS5 Disc Edition Console and tw..
$25.00
Lion Face decal skin for PS5 Disc Edition Console and two ..
Lion Face decal skin for PS5 Disc Edition Console and two ..
$25.00
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i