Product Added to your Cart
x

-------- OR --------

Default
CroatiaFranceHebrewHungaryVietnameseGreeceCzech RepublicDenmarkRomaniaFinland
USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Menu
0 items
PS5 Disc Skin's Store 2
500 product(s) found for "PS5 Disc Skin's Store 2"
The Simpsons decal skin for ..
PS5 Disc Skin's Store 2
The Simpsons decal skin for ..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Bloodborne decal skin for PS..
PS5 Disc Skin's Store 2
Bloodborne decal skin for PS..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Atomic Heart decal skin for ..
PS5 Disc Skin's Store 2
Atomic Heart decal skin for ..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Nier Automata decal skin for..
PS5 Disc Skin's Store 2
Nier Automata decal skin for..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Dragon Ball decal skin for P..
PS5 Disc Skin's Store 2
Dragon Ball decal skin for P..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
SCARLET NEXUS decal skin for..
PS5 Disc Skin's Store 2
SCARLET NEXUS decal skin for..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Ghost Bab decal skin for PS5..
PS5 Disc Skin's Store 2
Ghost Bab decal skin for PS5..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Anime Date A Live decal skin..
PS5 Disc Skin's Store 2
Anime Date A Live decal skin..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Anime One Piece decal skin f..
PS5 Disc Skin's Store 2
Anime One Piece decal skin f..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Overwatch Dva decal skin for..
PS5 Disc Skin's Store 2
Overwatch Dva decal skin for..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Kobe Bryant decal skin for P..
PS5 Disc Skin's Store 2
Kobe Bryant decal skin for P..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Kindom Hearts decal skin for..
PS5 Disc Skin's Store 2
Kindom Hearts decal skin for..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Black Rock Shooter decal ski..
PS5 Disc Skin's Store 2
Black Rock Shooter decal ski..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Air Jordan decal skin for PS..
PS5 Disc Skin's Store 2
Air Jordan decal skin for PS..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Pittsburgh Steelers decal sk..
PS5 Disc Skin's Store 2
Pittsburgh Steelers decal sk..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
NBA Jordan decal skin for PS..
PS5 Disc Skin's Store 2
NBA Jordan decal skin for PS..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
The Witcher Wild Hunt decal ..
PS5 Disc Skin's Store 2
The Witcher Wild Hunt decal ..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Wwe Bray Wyatt decal skin fo..
PS5 Disc Skin's Store 2
Wwe Bray Wyatt decal skin fo..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Game Call of Duty decal skin..
PS5 Disc Skin's Store 2
Game Call of Duty decal skin..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Movie Spiderman decal skin f..
PS5 Disc Skin's Store 2
Movie Spiderman decal skin f..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Fortnite decal skin for PS5 ..
PS5 Disc Skin's Store 2
Fortnite decal skin for PS5 ..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Neon Genesis Evangelion deca..
PS5 Disc Skin's Store 2
Neon Genesis Evangelion deca..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Clown Joker decal skin for P..
PS5 Disc Skin's Store 2
Clown Joker decal skin for P..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Anime Corner Creature decal ..
PS5 Disc Skin's Store 2
Anime Corner Creature decal ..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Pokemon Pikachu decal skin f..
PS5 Disc Skin's Store 2
Pokemon Pikachu decal skin f..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Hatsune Miku decal skin for ..
PS5 Disc Skin's Store 2
Hatsune Miku decal skin for ..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Dragon Ball decal skin for P..
PS5 Disc Skin's Store 2
Dragon Ball decal skin for P..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Anime Rick And Morty decal s..
PS5 Disc Skin's Store 2
Anime Rick And Morty decal s..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i