Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
Croatia Croatia France France Hebrew Hebrew Hungary Hungary Vietnamese Vietnamese Greece Greece Czech Republic Czech Republic Denmark Denmark Romania Romania Finland Finland
$0.00
PS5 Disc Skin's Store 2
Solid Color decal skin for PS5 Disc Edition Console and tw..
Solid Color decal skin for PS5 Disc Edition Console and tw..
$25.00
Solid Color decal skin for PS5 Disc Edition Console and tw..
Solid Color decal skin for PS5 Disc Edition Console and tw..
$25.00
Solid Color decal skin for PS5 Disc Edition Console and tw..
Solid Color decal skin for PS5 Disc Edition Console and tw..
$25.00
Solid Color decal skin for PS5 Disc Edition Console and tw..
Solid Color decal skin for PS5 Disc Edition Console and tw..
$25.00
Solid Color decal skin for PS5 Disc Edition Console and tw..
Solid Color decal skin for PS5 Disc Edition Console and tw..
$25.00
Solid Color decal skin for PS5 Disc Edition Console and tw..
Solid Color decal skin for PS5 Disc Edition Console and tw..
$25.00
Special edition decal skin for PS5 Disc Edition Console an..
Special edition decal skin for PS5 Disc Edition Console an..
$25.00
Special edition decal skin for PS5 Disc Edition Console an..
Special edition decal skin for PS5 Disc Edition Console an..
$25.00
Special edition decal skin for PS5 Disc Edition Console an..
Special edition decal skin for PS5 Disc Edition Console an..
$25.00
Special edition decal skin for PS5 Disc Edition Console an..
Special edition decal skin for PS5 Disc Edition Console an..
$25.00
Special Edition decal skin for PS5 Disc Edition Console an..
Special Edition decal skin for PS5 Disc Edition Console an..
$25.00
Special style decal skin for PS5 Disc Edition Console and ..
Special style decal skin for PS5 Disc Edition Console and ..
$25.00
Spider Man decal skin for PS5 Disc Edition Console and two..
Spider Man decal skin for PS5 Disc Edition Console and two..
$25.00
Spider Man decal skin for PS5 Disc Edition Console and two..
Spider Man decal skin for PS5 Disc Edition Console and two..
$25.00
Spider Man decal skin for PS5 Disc Edition Console and two..
Spider Man decal skin for PS5 Disc Edition Console and two..
$25.00
Spider Man decal skin for PS5 Disc Edition Console and two..
Spider Man decal skin for PS5 Disc Edition Console and two..
$25.00
Spider Man decal skin for PS5 Disc Edition Console and two..
Spider Man decal skin for PS5 Disc Edition Console and two..
$25.00
Spider Man decal skin for PS5 Disc Edition Console and two..
Spider Man decal skin for PS5 Disc Edition Console and two..
$25.00
Spider Man decal skin for PS5 Disc Edition Console and two..
Spider Man decal skin for PS5 Disc Edition Console and two..
$25.00
Spider Man decal skin for PS5 Disc Edition Console and two..
Spider Man decal skin for PS5 Disc Edition Console and two..
$25.00
Spiderman decal skin for PS5 Disc Edition Console and two ..
Spiderman decal skin for PS5 Disc Edition Console and two ..
$25.00
Spiderman decal skin for PS5 Disc Edition Console and two ..
Spiderman decal skin for PS5 Disc Edition Console and two ..
$25.00
Splinter Cell Conviction decal skin for PS5 Disc Edition C..
Splinter Cell Conviction decal skin for PS5 Disc Edition C..
$25.00
Sports Kobe Bryant decal skin for PS5 Disc Edition Console..
Sports Kobe Bryant decal skin for PS5 Disc Edition Console..
$25.00
Sports Kobe Bryant decal skin for PS5 Disc Edition Console..
Sports Kobe Bryant decal skin for PS5 Disc Edition Console..
$25.00
Star Wars Darth Vader decal skin for PS5 Disc Edition Cons..
Star Wars Darth Vader decal skin for PS5 Disc Edition Cons..
$25.00
Star Wars decal skin for PS5 Disc Edition Console and two ..
Star Wars decal skin for PS5 Disc Edition Console and two ..
$25.00
Star Wars Fallen Order decal skin for PS5 Disc Edition Con..
Star Wars Fallen Order decal skin for PS5 Disc Edition Con..
$25.00
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i