Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
Croatia Croatia France France Hebrew Hebrew Hungary Hungary Vietnamese Vietnamese Greece Greece Czech Republic Czech Republic Denmark Denmark Romania Romania Finland Finland
$0.00
PS5 Disc Skin's Store 2
Black Sky decal skin for PS5 Disc Edition Console and two ..
Black Sky decal skin for PS5 Disc Edition Console and two ..
$25.00
Blood texture decal skin for PS5 Disc Edition Console and ..
Blood texture decal skin for PS5 Disc Edition Console and ..
$25.00
Bloodborne decal skin for PS5 Disc Edition Console and two..
Bloodborne decal skin for PS5 Disc Edition Console and two..
$25.00
Blue Gradient decal skin for PS5 Disc Edition Console and ..
Blue Gradient decal skin for PS5 Disc Edition Console and ..
$25.00
Borderlands 3 decal skin for PS5 Disc Edition Console and ..
Borderlands 3 decal skin for PS5 Disc Edition Console and ..
$25.00
Borderlands 3 decal skin for PS5 Disc Edition Console and ..
Borderlands 3 decal skin for PS5 Disc Edition Console and ..
$25.00
Borderlands 3 decal skin for PS5 Disc Edition Console and ..
Borderlands 3 decal skin for PS5 Disc Edition Console and ..
$25.00
Broken Glass decal skin for PS5 Disc Edition Console and t..
Broken Glass decal skin for PS5 Disc Edition Console and t..
$25.00
Call of Duty decal skin for PS5 Disc Edition Console and t..
Call of Duty decal skin for PS5 Disc Edition Console and t..
$25.00
Camouflage Texture decal skin for PS5 Disc Edition Console..
Camouflage Texture decal skin for PS5 Disc Edition Console..
$25.00
Camouflage Texture decal skin for PS5 Disc Edition Console..
Camouflage Texture decal skin for PS5 Disc Edition Console..
$25.00
Camouflage Texture decal skin for PS5 Disc Edition Console..
Camouflage Texture decal skin for PS5 Disc Edition Console..
$25.00
Camouflage Texture decal skin for PS5 Disc Edition Console..
Camouflage Texture decal skin for PS5 Disc Edition Console..
$25.00
Camouflage Texture decal skin for PS5 Disc Edition Console..
Camouflage Texture decal skin for PS5 Disc Edition Console..
$25.00
Camouflage Texture decal skin for PS5 Disc Edition Console..
Camouflage Texture decal skin for PS5 Disc Edition Console..
$25.00
Camouflage Texture decal skin for PS5 Disc Edition Console..
Camouflage Texture decal skin for PS5 Disc Edition Console..
$25.00
Camouflage Texture decal skin for PS5 Disc Edition Console..
Camouflage Texture decal skin for PS5 Disc Edition Console..
$25.00
Camouflage Texture decal skin for PS5 Disc Edition Console..
Camouflage Texture decal skin for PS5 Disc Edition Console..
$25.00
Camouflage Texture decal skin for PS5 Disc Edition Console..
Camouflage Texture decal skin for PS5 Disc Edition Console..
$25.00
Camouflage Texture decal skin for PS5 Disc Edition Console..
Camouflage Texture decal skin for PS5 Disc Edition Console..
$25.00
Camouflage Texture decal skin for PS5 Disc Edition Console..
Camouflage Texture decal skin for PS5 Disc Edition Console..
$25.00
Carbon Fiber decal skin for PS5 Disc Edition Console and t..
Carbon Fiber decal skin for PS5 Disc Edition Console and t..
$25.00
Carbon Fiber decal skin for PS5 Disc Edition Console and t..
Carbon Fiber decal skin for PS5 Disc Edition Console and t..
$25.00
Carbon Fiber decal skin for PS5 Disc Edition Console and t..
Carbon Fiber decal skin for PS5 Disc Edition Console and t..
$25.00
Clown Joker decal skin for PS5 Disc Edition Console and tw..
Clown Joker decal skin for PS5 Disc Edition Console and tw..
$25.00
Clown The Joker decal skin for PS5 Disc Edition Console an..
Clown The Joker decal skin for PS5 Disc Edition Console an..
$25.00
Clown The Joker decal skin for PS5 Disc Edition Console an..
Clown The Joker decal skin for PS5 Disc Edition Console an..
$25.00
Clown The Joker decal skin for PS5 Disc Edition Console an..
Clown The Joker decal skin for PS5 Disc Edition Console an..
$25.00
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i