Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
Croatia Croatia France France Hebrew Hebrew Hungary Hungary Vietnamese Vietnamese Greece Greece Czech Republic Czech Republic Denmark Denmark Romania Romania Finland Finland
$0.00
PS5 Disc Skin's Store 2
Dead or Alive 6 decal skin for PS5 Disc Edition Console an..
Dead or Alive 6 decal skin for PS5 Disc Edition Console an..
$25.00
Dead or Alive 6 decal skin for PS5 Disc Edition Console an..
Dead or Alive 6 decal skin for PS5 Disc Edition Console an..
$25.00
Deadpool decal skin for PS5 Disc Edition Console and two C..
Deadpool decal skin for PS5 Disc Edition Console and two C..
$25.00
Deadpool decal skin for PS5 Disc Edition Console and two C..
Deadpool decal skin for PS5 Disc Edition Console and two C..
$25.00
Death Stranding decal skin for PS5 Disc Edition Console an..
Death Stranding decal skin for PS5 Disc Edition Console an..
$25.00
Demon Slayer Kimetsu no Yaiba decal skin for PS5 Disc Edit..
Demon Slayer Kimetsu no Yaiba decal skin for PS5 Disc Edit..
$25.00
Demon's Souls decal skin for PS5 Disc Edition Console and ..
Demon's Souls decal skin for PS5 Disc Edition Console and ..
$25.00
Destiny 2 decal skin for PS5 Disc Edition Console and two ..
Destiny 2 decal skin for PS5 Disc Edition Console and two ..
$25.00
Destiny 2 decal skin for PS5 Disc Edition Console and two ..
Destiny 2 decal skin for PS5 Disc Edition Console and two ..
$25.00
Destiny 2 decal skin for PS5 Disc Edition Console and two ..
Destiny 2 decal skin for PS5 Disc Edition Console and two ..
$25.00
Digital Texture decal skin for PS5 Disc Edition Console an..
Digital Texture decal skin for PS5 Disc Edition Console an..
$25.00
Digital Texture decal skin for PS5 Disc Edition Console an..
Digital Texture decal skin for PS5 Disc Edition Console an..
$25.00
Digital Texture decal skin for PS5 Disc Edition Console an..
Digital Texture decal skin for PS5 Disc Edition Console an..
$25.00
Digital Texture decal skin for PS5 Disc Edition Console an..
Digital Texture decal skin for PS5 Disc Edition Console an..
$25.00
Digital Texture decal skin for PS5 Disc Edition Console an..
Digital Texture decal skin for PS5 Disc Edition Console an..
$25.00
Digital Texture decal skin for PS5 Disc Edition Console an..
Digital Texture decal skin for PS5 Disc Edition Console an..
$25.00
Digital Texture decal skin for PS5 Disc Edition Console an..
Digital Texture decal skin for PS5 Disc Edition Console an..
$25.00
Digital Texture decal skin for PS5 Disc Edition Console an..
Digital Texture decal skin for PS5 Disc Edition Console an..
$25.00
Dirt 5 decal skin for PS5 Disc Edition Console and two Con..
Dirt 5 decal skin for PS5 Disc Edition Console and two Con..
$25.00
Dortmund FT decal skin for PS5 Disc Edition Console and tw..
Dortmund FT decal skin for PS5 Disc Edition Console and tw..
$25.00
Dragon Ball decal skin for PS5 Disc Edition Console and tw..
Dragon Ball decal skin for PS5 Disc Edition Console and tw..
$25.00
Dragon Ball decal skin for PS5 Disc Edition Console and tw..
Dragon Ball decal skin for PS5 Disc Edition Console and tw..
$25.00
Dragon Ball decal skin for PS5 Disc Edition Console and tw..
Dragon Ball decal skin for PS5 Disc Edition Console and tw..
$25.00
Dragon Ball decal skin for PS5 Disc Edition Console and tw..
Dragon Ball decal skin for PS5 Disc Edition Console and tw..
$25.00
Dragon Ball decal skin for PS5 Disc Edition Console and tw..
Dragon Ball decal skin for PS5 Disc Edition Console and tw..
$25.00
Dragon Ball decal skin for PS5 Disc Edition Console and tw..
Dragon Ball decal skin for PS5 Disc Edition Console and tw..
$25.00
Dragon Ball decal skin for PS5 Disc Edition Console and tw..
Dragon Ball decal skin for PS5 Disc Edition Console and tw..
$25.00
Dragon Ball decal skin for PS5 Disc Edition Console and tw..
Dragon Ball decal skin for PS5 Disc Edition Console and tw..
$25.00
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i