Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
Croatia Croatia France France Hebrew Hebrew Hungary Hungary Vietnamese Vietnamese Greece Greece Czech Republic Czech Republic Denmark Denmark Romania Romania Finland Finland
$0.00
PS5 Disc Skin's Store 3
The Last of Us decal skin for PS5 Disc Edition Console and..
The Last of Us decal skin for PS5 Disc Edition Console and..
$25.00
The Last of Us decal skin for PS5 Disc Edition Console and..
The Last of Us decal skin for PS5 Disc Edition Console and..
$25.00
The Last of Us decal skin for PS5 Disc Edition Console and..
The Last of Us decal skin for PS5 Disc Edition Console and..
$25.00
The Last of Us decal skin for PS5 Disc Edition Console and..
The Last of Us decal skin for PS5 Disc Edition Console and..
$25.00
The Last of Us decal skin for PS5 Disc Edition Console and..
The Last of Us decal skin for PS5 Disc Edition Console and..
$25.00
The Last of Us decal skin for PS5 Disc Edition Console and..
The Last of Us decal skin for PS5 Disc Edition Console and..
$25.00
The Last of Us decal skin for PS5 Disc Edition Console and..
The Last of Us decal skin for PS5 Disc Edition Console and..
$25.00
The Last of Us Red Dead Redemption decal skin for PS5 Disc..
The Last of Us Red Dead Redemption decal skin for PS5 Disc..
$25.00
The Witcher Wild Hunt decal skin for PS5 Disc Edition Cons..
The Witcher Wild Hunt decal skin for PS5 Disc Edition Cons..
$25.00
The Witcher Wild Hunt decal skin for PS5 Disc Edition Cons..
The Witcher Wild Hunt decal skin for PS5 Disc Edition Cons..
$25.00
Tokyo Avengers decal skin for PS5 Disc Edition Console and..
Tokyo Avengers decal skin for PS5 Disc Edition Console and..
$25.00
Tokyo Avengers decal skin for PS5 Disc Edition Console and..
Tokyo Avengers decal skin for PS5 Disc Edition Console and..
$25.00
Tokyo Ghoul decal skin for PS5 Disc Edition Console and tw..
Tokyo Ghoul decal skin for PS5 Disc Edition Console and tw..
$25.00
Tom And Jerry decal skin for PS5 Disc Edition Console and ..
Tom And Jerry decal skin for PS5 Disc Edition Console and ..
$25.00
TP Link decal skin for PS5 Disc Edition Console and two Co..
TP Link decal skin for PS5 Disc Edition Console and two Co..
$25.00
TP Link decal skin for PS5 Disc Edition Console and two Co..
TP Link decal skin for PS5 Disc Edition Console and two Co..
$25.00
Trabzonspor FT decal skin for PS5 Disc Edition Console and..
Trabzonspor FT decal skin for PS5 Disc Edition Console and..
$25.00
Trabzonspor FT decal skin for PS5 Disc Edition Console and..
Trabzonspor FT decal skin for PS5 Disc Edition Console and..
$25.00
Uncharted 4 decal skin for PS5 Disc Edition Console and tw..
Uncharted 4 decal skin for PS5 Disc Edition Console and tw..
$25.00
Union Jack decal skin for PS5 Disc Edition Console and two..
Union Jack decal skin for PS5 Disc Edition Console and two..
$25.00
Unisex Style decal skin for PS5 Disc Edition Console and t..
Unisex Style decal skin for PS5 Disc Edition Console and t..
$25.00
Unisex Style decal skin for PS5 Disc Edition Console and t..
Unisex Style decal skin for PS5 Disc Edition Console and t..
$25.00
Unisex Style decal skin for PS5 Disc Edition Console and t..
Unisex Style decal skin for PS5 Disc Edition Console and t..
$25.00
Unisex Style decal skin for PS5 Disc Edition Console and t..
Unisex Style decal skin for PS5 Disc Edition Console and t..
$25.00
Unisex Style decal skin for PS5 Disc Edition Console and t..
Unisex Style decal skin for PS5 Disc Edition Console and t..
$25.00
Unisex Style decal skin for PS5 Disc Edition Console and t..
Unisex Style decal skin for PS5 Disc Edition Console and t..
$25.00
Unisex Style decal skin for PS5 Disc Edition Console and t..
Unisex Style decal skin for PS5 Disc Edition Console and t..
$25.00
Unisex Style decal skin for PS5 Disc Edition Console and t..
Unisex Style decal skin for PS5 Disc Edition Console and t..
$25.00
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i