Product Added to your Cart
x

-------- OR --------

Default
CroatiaFranceHebrewHungaryVietnameseGreeceCzech RepublicDenmarkRomaniaFinland
USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Menu
0 items
PS5 Disc Skin's Store 3
500 product(s) found for "PS5 Disc Skin's Store 3"
NBA 2K23 decal skin for PS5 ..
PS5 Disc Skin's Store 3
NBA 2K23 decal skin for PS5 ..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Dragon Ball decal skin for P..
PS5 Disc Skin's Store 3
Dragon Ball decal skin for P..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Skeleton decal skin for PS5 ..
PS5 Disc Skin's Store 3
Skeleton decal skin for PS5 ..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Persona decal skin for PS5 D..
PS5 Disc Skin's Store 3
Persona decal skin for PS5 D..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Black Clover decal skin for ..
PS5 Disc Skin's Store 3
Black Clover decal skin for ..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Horizon Forbidden West decal..
PS5 Disc Skin's Store 3
Horizon Forbidden West decal..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Horizon Forbidden West decal..
PS5 Disc Skin's Store 3
Horizon Forbidden West decal..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Horizon Forbidden West decal..
PS5 Disc Skin's Store 3
Horizon Forbidden West decal..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Hell's Paradise Jigokuraku d..
PS5 Disc Skin's Store 3
Hell's Paradise Jigokuraku d..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Hell's Paradise Jigokuraku d..
PS5 Disc Skin's Store 3
Hell's Paradise Jigokuraku d..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Hell's Paradise Jigokuraku d..
PS5 Disc Skin's Store 3
Hell's Paradise Jigokuraku d..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Demon Slayer decal skin for ..
PS5 Disc Skin's Store 3
Demon Slayer decal skin for ..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Demon Slayer decal skin for ..
PS5 Disc Skin's Store 3
Demon Slayer decal skin for ..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Demon Slayer decal skin for ..
PS5 Disc Skin's Store 3
Demon Slayer decal skin for ..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Bloodborne decal skin for PS..
PS5 Disc Skin's Store 3
Bloodborne decal skin for PS..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Anime Cute Girl decal skin f..
PS5 Disc Skin's Store 3
Anime Cute Girl decal skin f..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Venom decal skin for PS5 Dis..
PS5 Disc Skin's Store 3
Venom decal skin for PS5 Dis..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
God of War Ragnarok decal sk..
PS5 Disc Skin's Store 3
God of War Ragnarok decal sk..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Dragon Ball decal skin for P..
PS5 Disc Skin's Store 3
Dragon Ball decal skin for P..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Journey of Suzuya decal skin..
PS5 Disc Skin's Store 3
Journey of Suzuya decal skin..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Gundam decal skin for PS5 Di..
PS5 Disc Skin's Store 3
Gundam decal skin for PS5 Di..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Spiderman decal skin for PS5..
PS5 Disc Skin's Store 3
Spiderman decal skin for PS5..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Apex Legends decal skin for ..
PS5 Disc Skin's Store 3
Apex Legends decal skin for ..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Gradient Colors decal skin f..
PS5 Disc Skin's Store 3
Gradient Colors decal skin f..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Iron Man decal skin for PS5 ..
PS5 Disc Skin's Store 3
Iron Man decal skin for PS5 ..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Kanagawa decal skin for PS5 ..
PS5 Disc Skin's Store 3
Kanagawa decal skin for PS5 ..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Hogwarts Legacy decal skin f..
PS5 Disc Skin's Store 3
Hogwarts Legacy decal skin f..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Hogwarts Legacy decal skin f..
PS5 Disc Skin's Store 3
Hogwarts Legacy decal skin f..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i