Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
Croatia Croatia France France Hebrew Hebrew Hungary Hungary Vietnamese Vietnamese Greece Greece Czech Republic Czech Republic Denmark Denmark Romania Romania Finland Finland
$0.00
PS5 Disc Skin's Store 3
Fortnite Battle Royale decal skin for PS5 Disc Edition Con..
Fortnite Battle Royale decal skin for PS5 Disc Edition Con..
$25.00
Fortnite decal skin for PS5 Disc Edition Console and two C..
Fortnite decal skin for PS5 Disc Edition Console and two C..
$25.00
Fortnite decal skin for PS5 Disc Edition Console and two C..
Fortnite decal skin for PS5 Disc Edition Console and two C..
$25.00
Fortnite decal skin for PS5 Disc Edition Console and two C..
Fortnite decal skin for PS5 Disc Edition Console and two C..
$25.00
Fortnite decal skin for PS5 Disc Edition Console and two C..
Fortnite decal skin for PS5 Disc Edition Console and two C..
$25.00
Fortnite decal skin for PS5 Disc Edition Console and two C..
Fortnite decal skin for PS5 Disc Edition Console and two C..
$25.00
Friday The 13th Jason decal skin for PS5 Disc Edition Cons..
Friday The 13th Jason decal skin for PS5 Disc Edition Cons..
$25.00
Galatasaray SK decal skin for PS5 Disc Edition Console and..
Galatasaray SK decal skin for PS5 Disc Edition Console and..
$25.00
Galatasaray SK decal skin for PS5 Disc Edition Console and..
Galatasaray SK decal skin for PS5 Disc Edition Console and..
$25.00
Galatasaray SK decal skin for PS5 Disc Edition Console and..
Galatasaray SK decal skin for PS5 Disc Edition Console and..
$25.00
Galatasaray SK decal skin for PS5 Disc Edition Console and..
Galatasaray SK decal skin for PS5 Disc Edition Console and..
$25.00
Galatasaray SK decal skin for PS5 Disc Edition Console and..
Galatasaray SK decal skin for PS5 Disc Edition Console and..
$25.00
Galatasaray SK decal skin for PS5 Disc Edition Console and..
Galatasaray SK decal skin for PS5 Disc Edition Console and..
$25.00
Galatasaray SK decal skin for PS5 Disc Edition Console and..
Galatasaray SK decal skin for PS5 Disc Edition Console and..
$25.00
Game Devil May Cry decal skin for PS5 Disc Edition Console..
Game Devil May Cry decal skin for PS5 Disc Edition Console..
$25.00
Game Fortnite decal skin for PS5 Disc Edition Console and ..
Game Fortnite decal skin for PS5 Disc Edition Console and ..
$25.00
Game of Thrones decal skin for PS5 Disc Edition Console an..
Game of Thrones decal skin for PS5 Disc Edition Console an..
$25.00
Game of Thrones decal skin for PS5 Disc Edition Console an..
Game of Thrones decal skin for PS5 Disc Edition Console an..
$25.00
Gawr Gura decal skin for PS5 Disc Edition Console and two ..
Gawr Gura decal skin for PS5 Disc Edition Console and two ..
$25.00
Genshin Impact decal skin for PS5 Disc Edition Console and..
Genshin Impact decal skin for PS5 Disc Edition Console and..
$25.00
Geometric Shapes decal skin for PS5 Disc Edition Console a..
Geometric Shapes decal skin for PS5 Disc Edition Console a..
$25.00
Ghost of Tsushima decal skin for PS5 Disc Edition Console ..
Ghost of Tsushima decal skin for PS5 Disc Edition Console ..
$25.00
Ghostwire Tokyo decal skin for PS5 Disc Edition Console an..
Ghostwire Tokyo decal skin for PS5 Disc Edition Console an..
$25.00
God of War decal skin for PS5 Disc Edition Console and two..
God of War decal skin for PS5 Disc Edition Console and two..
$25.00
God of War decal skin for PS5 Disc Edition Console and two..
God of War decal skin for PS5 Disc Edition Console and two..
$25.00
God of War decal skin for PS5 Disc Edition Console and two..
God of War decal skin for PS5 Disc Edition Console and two..
$25.00
God of War decal skin for PS5 Disc Edition Console and two..
God of War decal skin for PS5 Disc Edition Console and two..
$25.00
God of War decal skin for PS5 Disc Edition Console and two..
God of War decal skin for PS5 Disc Edition Console and two..
$25.00
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i