Product Added to your Cart
x

-------- OR --------

Default
CroatiaFranceHebrewHungaryVietnameseGreeceCzech RepublicDenmarkRomaniaFinland
USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Menu
0 items
PS5 Disc Skin's Store 4
500 product(s) found for "PS5 Disc Skin's Store 4"
Granada FC decal skin for PS..
PS5 Disc Skin's Store 4
Granada FC decal skin for PS..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
German football team decal s..
PS5 Disc Skin's Store 4
German football team decal s..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Green Gradient decal skin fo..
PS5 Disc Skin's Store 4
Green Gradient decal skin fo..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
NFL Dallas Cowboys decal ski..
PS5 Disc Skin's Store 4
NFL Dallas Cowboys decal ski..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
NFL Tampa Bay Buccaneers dec..
PS5 Disc Skin's Store 4
NFL Tampa Bay Buccaneers dec..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
NFL Carolina Panthers decal ..
PS5 Disc Skin's Store 4
NFL Carolina Panthers decal ..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
NFL Texas Rangers decal skin..
PS5 Disc Skin's Store 4
NFL Texas Rangers decal skin..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
NBA Jordan decal skin for PS..
PS5 Disc Skin's Store 4
NBA Jordan decal skin for PS..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
NBA Cavaliers decal skin for..
PS5 Disc Skin's Store 4
NBA Cavaliers decal skin for..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
NBA Knicks decal skin for PS..
PS5 Disc Skin's Store 4
NBA Knicks decal skin for PS..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
NBA Lakers decal skin for PS..
PS5 Disc Skin's Store 4
NBA Lakers decal skin for PS..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Demon's Souls decal skin for..
PS5 Disc Skin's Store 4
Demon's Souls decal skin for..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Demon's Souls decal skin for..
PS5 Disc Skin's Store 4
Demon's Souls decal skin for..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Demon's Souls decal skin for..
PS5 Disc Skin's Store 4
Demon's Souls decal skin for..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Spider Man decal skin for PS..
PS5 Disc Skin's Store 4
Spider Man decal skin for PS..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Venom decal skin for PS5 Dis..
PS5 Disc Skin's Store 4
Venom decal skin for PS5 Dis..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Dragon Ball decal skin for P..
PS5 Disc Skin's Store 4
Dragon Ball decal skin for P..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Dragon Ball decal skin for P..
PS5 Disc Skin's Store 4
Dragon Ball decal skin for P..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Star Wars Darth Vader decal ..
PS5 Disc Skin's Store 4
Star Wars Darth Vader decal ..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Dragon Ball decal skin for P..
PS5 Disc Skin's Store 4
Dragon Ball decal skin for P..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Carbon Fiber decal skin for ..
PS5 Disc Skin's Store 4
Carbon Fiber decal skin for ..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Carbon Fiber decal skin for ..
PS5 Disc Skin's Store 4
Carbon Fiber decal skin for ..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Carbon Fiber decal skin for ..
PS5 Disc Skin's Store 4
Carbon Fiber decal skin for ..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Carbon Fiber decal skin for ..
PS5 Disc Skin's Store 4
Carbon Fiber decal skin for ..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Carbon Fiber decal skin for ..
PS5 Disc Skin's Store 4
Carbon Fiber decal skin for ..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Carbon Fiber decal skin for ..
PS5 Disc Skin's Store 4
Carbon Fiber decal skin for ..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Spider Man decal skin for PS..
PS5 Disc Skin's Store 4
Spider Man decal skin for PS..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Spider Man decal skin for PS..
PS5 Disc Skin's Store 4
Spider Man decal skin for PS..
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
$25.00
Units in Stock: 999
$25.00
Details
Add To Cart
Superior Quality, Vibrant, "Anti-Slip" Long-lasting Sticker Compatible with Two Dualshock Controllers and the Sony PlayStaion 5 Next-Gen Console Accurately cut, with simple access for connectors, buttons,...
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i