Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
Croatia Croatia France France Hebrew Hebrew Hungary Hungary Vietnamese Vietnamese Greece Greece Czech Republic Czech Republic Denmark Denmark Romania Romania Finland Finland
$0.00
PS5 Disc Skin's Store 4
Clown The Joker decal skin for PS5 Disc Edition Console an..
Clown The Joker decal skin for PS5 Disc Edition Console an..
$25.00
Clown The Joker decal skin for PS5 Disc Edition Console an..
Clown The Joker decal skin for PS5 Disc Edition Console an..
$25.00
Clown The Joker decal skin for PS5 Disc Edition Console an..
Clown The Joker decal skin for PS5 Disc Edition Console an..
$25.00
Clown The Joker decal skin for PS5 Disc Edition Console an..
Clown The Joker decal skin for PS5 Disc Edition Console an..
$25.00
Clown The Joker decal skin for PS5 Disc Edition Console an..
Clown The Joker decal skin for PS5 Disc Edition Console an..
$25.00
Clown The Joker decal skin for PS5 Disc Edition Console an..
Clown The Joker decal skin for PS5 Disc Edition Console an..
$25.00
COD Modern Warfare decal skin for PS5 Disc Edition Console..
COD Modern Warfare decal skin for PS5 Disc Edition Console..
$25.00
COD Modern Warfare decal skin for PS5 Disc Edition Console..
COD Modern Warfare decal skin for PS5 Disc Edition Console..
$25.00
COD Modern Warfare decal skin for PS5 Disc Edition Console..
COD Modern Warfare decal skin for PS5 Disc Edition Console..
$25.00
COD Modern Warfare decal skin for PS5 Disc Edition Console..
COD Modern Warfare decal skin for PS5 Disc Edition Console..
$25.00
COD Modern Warfare decal skin for PS5 Disc Edition Console..
COD Modern Warfare decal skin for PS5 Disc Edition Console..
$25.00
COD Warzone decal skin for PS5 Disc Edition Console and tw..
COD Warzone decal skin for PS5 Disc Edition Console and tw..
$25.00
COD Warzone decal skin for PS5 Disc Edition Console and tw..
COD Warzone decal skin for PS5 Disc Edition Console and tw..
$25.00
Crash Bandicoot 4 It's About Time decal skin for PS5 Disc ..
Crash Bandicoot 4 It's About Time decal skin for PS5 Disc ..
$25.00
Crash Bandicoot 4 It's About Time decal skin for PS5 Disc ..
Crash Bandicoot 4 It's About Time decal skin for PS5 Disc ..
$25.00
Cuphead decal skin for PS5 Disc Edition Console and two Co..
Cuphead decal skin for PS5 Disc Edition Console and two Co..
$25.00
Cuphead decal skin for PS5 Disc Edition Console and two Co..
Cuphead decal skin for PS5 Disc Edition Console and two Co..
$25.00
Cuphead decal skin for PS5 Disc Edition Console and two Co..
Cuphead decal skin for PS5 Disc Edition Console and two Co..
$25.00
Cuphead decal skin for PS5 Disc Edition Console and two Co..
Cuphead decal skin for PS5 Disc Edition Console and two Co..
$25.00
Cyberpunk 2077 decal skin for PS5 Disc Edition Console and..
Cyberpunk 2077 decal skin for PS5 Disc Edition Console and..
$25.00
Cyberpunk 2077 decal skin for PS5 Disc Edition Console and..
Cyberpunk 2077 decal skin for PS5 Disc Edition Console and..
$25.00
Cyberpunk 2077 decal skin for PS5 Disc Edition Console and..
Cyberpunk 2077 decal skin for PS5 Disc Edition Console and..
$25.00
Cyberpunk 2077 decal skin for PS5 Disc Edition Console and..
Cyberpunk 2077 decal skin for PS5 Disc Edition Console and..
$25.00
Cyberpunk 2077 decal skin for PS5 Disc Edition Console and..
Cyberpunk 2077 decal skin for PS5 Disc Edition Console and..
$25.00
Cyberpunk 2077 decal skin for PS5 Disc Edition Console and..
Cyberpunk 2077 decal skin for PS5 Disc Edition Console and..
$25.00
Cyberpunk 2077 decal skin for PS5 Disc Edition Console and..
Cyberpunk 2077 decal skin for PS5 Disc Edition Console and..
$25.00
Cyberpunk 2077 decal skin for PS5 Disc Edition Console and..
Cyberpunk 2077 decal skin for PS5 Disc Edition Console and..
$25.00
Cyberpunk 2077 decal skin for PS5 Disc Edition Console and..
Cyberpunk 2077 decal skin for PS5 Disc Edition Console and..
$25.00
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i