Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
Croatia Croatia France France Hebrew Hebrew Hungary Hungary Vietnamese Vietnamese Greece Greece Czech Republic Czech Republic Denmark Denmark Romania Romania Finland Finland
$0.00
PS5 Disc Skin's Store 4
Digital Texture decal skin for PS5 Disc Edition Console an..
Digital Texture decal skin for PS5 Disc Edition Console an..
$25.00
Digital Texture decal skin for PS5 Disc Edition Console an..
Digital Texture decal skin for PS5 Disc Edition Console an..
$25.00
Digital Texture decal skin for PS5 Disc Edition Console an..
Digital Texture decal skin for PS5 Disc Edition Console an..
$25.00
Digital Texture decal skin for PS5 Disc Edition Console an..
Digital Texture decal skin for PS5 Disc Edition Console an..
$25.00
Digital Texture decal skin for PS5 Disc Edition Console an..
Digital Texture decal skin for PS5 Disc Edition Console an..
$25.00
Dirt 5 decal skin for PS5 Disc Edition Console and two Con..
Dirt 5 decal skin for PS5 Disc Edition Console and two Con..
$25.00
Dirt 5 decal skin for PS5 Disc Edition Console and two Con..
Dirt 5 decal skin for PS5 Disc Edition Console and two Con..
$25.00
Dissidia Final Fantasy decal skin for PS5 Disc Edition Con..
Dissidia Final Fantasy decal skin for PS5 Disc Edition Con..
$25.00
Dissidia Final Fantasy decal skin for PS5 Disc Edition Con..
Dissidia Final Fantasy decal skin for PS5 Disc Edition Con..
$25.00
Dragon Ball decal skin for PS5 Disc Edition Console and tw..
Dragon Ball decal skin for PS5 Disc Edition Console and tw..
$25.00
Dragon Ball decal skin for PS5 Disc Edition Console and tw..
Dragon Ball decal skin for PS5 Disc Edition Console and tw..
$25.00
Dragon Ball decal skin for PS5 Disc Edition Console and tw..
Dragon Ball decal skin for PS5 Disc Edition Console and tw..
$25.00
Dragon Ball decal skin for PS5 Disc Edition Console and tw..
Dragon Ball decal skin for PS5 Disc Edition Console and tw..
$25.00
Dragon Ball decal skin for PS5 Disc Edition Console and tw..
Dragon Ball decal skin for PS5 Disc Edition Console and tw..
$25.00
Dragon Ball decal skin for PS5 Disc Edition Console and tw..
Dragon Ball decal skin for PS5 Disc Edition Console and tw..
$25.00
Dragon Ball decal skin for PS5 Disc Edition Console and tw..
Dragon Ball decal skin for PS5 Disc Edition Console and tw..
$25.00
Dragon Ball decal skin for PS5 Disc Edition Console and tw..
Dragon Ball decal skin for PS5 Disc Edition Console and tw..
$25.00
Dragon Quest 11 decal skin for PS5 Disc Edition Console an..
Dragon Quest 11 decal skin for PS5 Disc Edition Console an..
$25.00
Dragon Quest decal skin for PS5 Disc Edition Console and t..
Dragon Quest decal skin for PS5 Disc Edition Console and t..
$25.00
Eintracht Frankfurt decal skin for PS5 Disc Edition Consol..
Eintracht Frankfurt decal skin for PS5 Disc Edition Consol..
$25.00
Fairy Tail decal skin for PS5 Disc Edition Console and two..
Fairy Tail decal skin for PS5 Disc Edition Console and two..
$25.00
Far Cry 5 decal skin for PS5 Disc Edition Console and two ..
Far Cry 5 decal skin for PS5 Disc Edition Console and two ..
$25.00
Far Cry 5 decal skin for PS5 Disc Edition Console and two ..
Far Cry 5 decal skin for PS5 Disc Edition Console and two ..
$25.00
Far Cry 5 decal skin for PS5 Disc Edition Console and two ..
Far Cry 5 decal skin for PS5 Disc Edition Console and two ..
$25.00
Far Cry 5 decal skin for PS5 Disc Edition Console and two ..
Far Cry 5 decal skin for PS5 Disc Edition Console and two ..
$25.00
Far Cry 5 decal skin for PS5 Disc Edition Console and two ..
Far Cry 5 decal skin for PS5 Disc Edition Console and two ..
$25.00
Far Cry 6 decal skin for PS5 Disc Edition Console and two ..
Far Cry 6 decal skin for PS5 Disc Edition Console and two ..
$25.00
Far Cry 6 decal skin for PS5 Disc Edition Console and two ..
Far Cry 6 decal skin for PS5 Disc Edition Console and two ..
$25.00
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i