Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
Croatia Croatia France France Hebrew Hebrew Hungary Hungary Vietnamese Vietnamese Greece Greece Czech Republic Czech Republic Denmark Denmark Romania Romania Finland Finland
$0.00
PS5 Digital New Store
PS5 Digital New Store
PS5 Digital New Store 1 PS5 Digital New Store 2 PS5 Digital New Store 3
Aberdeen Football Club decal skin for PS5 Digital Console ..
Aberdeen Football Club decal skin for PS5 Digital Console ..
$25.00
ACE Combat 7 decal skin for PS5 Digital Console and two Co..
ACE Combat 7 decal skin for PS5 Digital Console and two Co..
$25.00
Anime Ayane decal skin for PS5 Digital Console and two Con..
Anime Ayane decal skin for PS5 Digital Console and two Con..
$25.00
Anime decal skin for PS5 Digital Console and two Controllers
Anime decal skin for PS5 Digital Console and two Controllers
$25.00
Anime decal skin for PS5 Digital Console and two Controllers
Anime decal skin for PS5 Digital Console and two Controllers
$25.00
Anime decal skin for PS5 Digital Console and two Controllers
Anime decal skin for PS5 Digital Console and two Controllers
$25.00
Anime decal skin for PS5 Digital Console and two Controllers
Anime decal skin for PS5 Digital Console and two Controllers
$25.00
Anime decal skin for PS5 Digital Console and two Controllers
Anime decal skin for PS5 Digital Console and two Controllers
$25.00
Anime Girl decal skin for PS5 Digital Console and two Cont..
Anime Girl decal skin for PS5 Digital Console and two Cont..
$25.00
Anime Girl decal skin for PS5 Digital Console and two Cont..
Anime Girl decal skin for PS5 Digital Console and two Cont..
$25.00
Anime Girl decal skin for PS5 Digital Console and two Cont..
Anime Girl decal skin for PS5 Digital Console and two Cont..
$25.00
Anime Girl decal skin for PS5 Digital Console and two Cont..
Anime Girl decal skin for PS5 Digital Console and two Cont..
$25.00
Anime Girl decal skin for PS5 Digital Console and two Cont..
Anime Girl decal skin for PS5 Digital Console and two Cont..
$25.00
Anime Girl decal skin for PS5 Digital Console and two Cont..
Anime Girl decal skin for PS5 Digital Console and two Cont..
$25.00
Anime Girl decal skin for PS5 Digital Console and two Cont..
Anime Girl decal skin for PS5 Digital Console and two Cont..
$25.00
Anime Girl decal skin for PS5 Digital Console and two Cont..
Anime Girl decal skin for PS5 Digital Console and two Cont..
$25.00
Anime Girl decal skin for PS5 Digital Console and two Cont..
Anime Girl decal skin for PS5 Digital Console and two Cont..
$25.00
Anime Girl decal skin for PS5 Digital Console and two Cont..
Anime Girl decal skin for PS5 Digital Console and two Cont..
$25.00
Anime Girl decal skin for PS5 Digital Console and two Cont..
Anime Girl decal skin for PS5 Digital Console and two Cont..
$25.00
Anime Girl decal skin for PS5 Digital Console and two Cont..
Anime Girl decal skin for PS5 Digital Console and two Cont..
$25.00
Anime Girl decal skin for PS5 Digital Console and two Cont..
Anime Girl decal skin for PS5 Digital Console and two Cont..
$25.00
Anime Girl decal skin for PS5 Digital Console and two Cont..
Anime Girl decal skin for PS5 Digital Console and two Cont..
$25.00
Anime Girl decal skin for PS5 Digital Console and two Cont..
Anime Girl decal skin for PS5 Digital Console and two Cont..
$25.00
Anime Girl decal skin for PS5 Digital Console and two Cont..
Anime Girl decal skin for PS5 Digital Console and two Cont..
$25.00
Anime Girl Kawaii Waifu decal skin for PS5 Digital Console..
Anime Girl Kawaii Waifu decal skin for PS5 Digital Console..
$25.00
Anime Girls decal skin for PS5 Digital Console and two Con..
Anime Girls decal skin for PS5 Digital Console and two Con..
$25.00
Aquamarine Hoshino decal skin for PS5 Digital Console and ..
Aquamarine Hoshino decal skin for PS5 Digital Console and ..
$25.00
Arcane Jinx decal skin for PS5 Digital Console and two Con..
Arcane Jinx decal skin for PS5 Digital Console and two Con..
$25.00
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i