Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
Croatia Croatia France France Hebrew Hebrew Hungary Hungary Vietnamese Vietnamese Greece Greece Czech Republic Czech Republic Denmark Denmark Romania Romania Finland Finland
$0.00
PS5 Digital New Store
PS5 Digital New Store
PS5 Digital New Store 1 PS5 Digital New Store 2 PS5 Digital New Store 3
Death Stranding decal skin for PS5 Digital Console and two..
Death Stranding decal skin for PS5 Digital Console and two..
$25.00
Death Stranding decal skin for PS5 Digital Console and two..
Death Stranding decal skin for PS5 Digital Console and two..
$25.00
Demon Slayer decal skin for PS5 Digital Console and two Co..
Demon Slayer decal skin for PS5 Digital Console and two Co..
$25.00
Demon Slayer decal skin for PS5 Digital Console and two Co..
Demon Slayer decal skin for PS5 Digital Console and two Co..
$25.00
Devil May Cry 5 decal skin for PS5 Digital Console and two..
Devil May Cry 5 decal skin for PS5 Digital Console and two..
$25.00
Devil May Cry 5 decal skin for PS5 Digital Console and two..
Devil May Cry 5 decal skin for PS5 Digital Console and two..
$25.00
Diablo 4 decal skin for PS5 Digital Console and two Contro..
Diablo 4 decal skin for PS5 Digital Console and two Contro..
$25.00
Diablo 4 decal skin for PS5 Digital Console and two Contro..
Diablo 4 decal skin for PS5 Digital Console and two Contro..
$25.00
Diablo 4 decal skin for PS5 Digital Console and two Contro..
Diablo 4 decal skin for PS5 Digital Console and two Contro..
$25.00
Diablo 4 decal skin for PS5 Digital Console and two Contro..
Diablo 4 decal skin for PS5 Digital Console and two Contro..
$25.00
Diablo 4 decal skin for PS5 Digital Console and two Contro..
Diablo 4 decal skin for PS5 Digital Console and two Contro..
$25.00
Diablo 4 decal skin for PS5 Digital Console and two Contro..
Diablo 4 decal skin for PS5 Digital Console and two Contro..
$25.00
Doraemon decal skin for PS5 Digital Console and two Contro..
Doraemon decal skin for PS5 Digital Console and two Contro..
$25.00
Doraemon decal skin for PS5 Digital Console and two Contro..
Doraemon decal skin for PS5 Digital Console and two Contro..
$25.00
Doraemon decal skin for PS5 Digital Console and two Contro..
Doraemon decal skin for PS5 Digital Console and two Contro..
$25.00
Dragon Ball decal skin for PS5 Digital Console and two Co..
Dragon Ball decal skin for PS5 Digital Console and two Co..
$25.00
Dragon Ball decal skin for PS5 Digital Console and two Con..
Dragon Ball decal skin for PS5 Digital Console and two Con..
$25.00
Dragon Ball decal skin for PS5 Digital Console and two Con..
Dragon Ball decal skin for PS5 Digital Console and two Con..
$25.00
Dragon Ball decal skin for PS5 Digital Console and two Con..
Dragon Ball decal skin for PS5 Digital Console and two Con..
$25.00
Dragon Ball decal skin for PS5 Digital Console and two Con..
Dragon Ball decal skin for PS5 Digital Console and two Con..
$25.00
Dragon Ball decal skin for PS5 Digital Console and two Con..
Dragon Ball decal skin for PS5 Digital Console and two Con..
$25.00
Dragon Ball decal skin for PS5 Digital Console and two Con..
Dragon Ball decal skin for PS5 Digital Console and two Con..
$25.00
Dragon Ball Fighter Z decal skin for PS5 Digital Console a..
Dragon Ball Fighter Z decal skin for PS5 Digital Console a..
$25.00
Dragon Ball Goku decal skin for PS5 Digital Console and tw..
Dragon Ball Goku decal skin for PS5 Digital Console and tw..
$25.00
Dragon Ball Goku decal skin for PS5 Digital Console and tw..
Dragon Ball Goku decal skin for PS5 Digital Console and tw..
$25.00
Dragon Ball Goku decal skin for PS5 Digital Console and tw..
Dragon Ball Goku decal skin for PS5 Digital Console and tw..
$25.00
Dragon Ball Goku decal skin for PS5 Digital Console and tw..
Dragon Ball Goku decal skin for PS5 Digital Console and tw..
$25.00
Dragon Ball Goku decal skin for PS5 Digital Console and tw..
Dragon Ball Goku decal skin for PS5 Digital Console and tw..
$25.00
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i