Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
Croatia Croatia France France Hebrew Hebrew Hungary Hungary Vietnamese Vietnamese Greece Greece Czech Republic Czech Republic Denmark Denmark Romania Romania Finland Finland
$0.00
PS5 Digital New Store 3
Kumamon decal skin for PS5 Digital Console and two Control..
Kumamon decal skin for PS5 Digital Console and two Control..
$25.00
Kumamon decal skin for PS5 Digital Console and two Control..
Kumamon decal skin for PS5 Digital Console and two Control..
$25.00
Kumamon decal skin for PS5 Digital Console and two Control..
Kumamon decal skin for PS5 Digital Console and two Control..
$25.00
Kumamon decal skin for PS5 Digital Console and two Control..
Kumamon decal skin for PS5 Digital Console and two Control..
$25.00
Elden Ring decal skin for PS5 Digital Console and two Cont..
Elden Ring decal skin for PS5 Digital Console and two Cont..
$25.00
Elden Ring decal skin for PS5 Digital Console and two Cont..
Elden Ring decal skin for PS5 Digital Console and two Cont..
$25.00
Elden Ring decal skin for PS5 Digital Console and two Cont..
Elden Ring decal skin for PS5 Digital Console and two Cont..
$25.00
Elden Ring decal skin for PS5 Digital Console and two Cont..
Elden Ring decal skin for PS5 Digital Console and two Cont..
$25.00
Elden Ring decal skin for PS5 Digital Console and two Cont..
Elden Ring decal skin for PS5 Digital Console and two Cont..
$25.00
Elden Ring decal skin for PS5 Digital Console and two Cont..
Elden Ring decal skin for PS5 Digital Console and two Cont..
$25.00
Elden Ring decal skin for PS5 Digital Console and two Cont..
Elden Ring decal skin for PS5 Digital Console and two Cont..
$25.00
Elden Ring decal skin for PS5 Digital Console and two Cont..
Elden Ring decal skin for PS5 Digital Console and two Cont..
$25.00
Elden Ring decal skin for PS5 Digital Console and two Cont..
Elden Ring decal skin for PS5 Digital Console and two Cont..
$25.00
Elden Ring decal skin for PS5 Digital Console and two Cont..
Elden Ring decal skin for PS5 Digital Console and two Cont..
$25.00
Call of Duty Warzone decal skin for PS5 Digital Console an..
Call of Duty Warzone decal skin for PS5 Digital Console an..
$25.00
Call of Duty Warzone decal skin for PS5 Digital Console an..
Call of Duty Warzone decal skin for PS5 Digital Console an..
$25.00
Mortal Kombat decal skin for PS5 Digital Console and two C..
Mortal Kombat decal skin for PS5 Digital Console and two C..
$25.00
Joker decal skin for PS5 Digital Console and two Controllers
Joker decal skin for PS5 Digital Console and two Controllers
$25.00
Batman decal skin for PS5 Digital Console and two Controll..
Batman decal skin for PS5 Digital Console and two Controll..
$25.00
Batman decal skin for PS5 Digital Console and two Controll..
Batman decal skin for PS5 Digital Console and two Controll..
$25.00
Batman decal skin for PS5 Digital Console and two Controll..
Batman decal skin for PS5 Digital Console and two Controll..
$25.00
Gingerbread man decal skin for PS5 Digital Console and two..
Gingerbread man decal skin for PS5 Digital Console and two..
$25.00
Minions decal skin for PS5 Digital Console and two Control..
Minions decal skin for PS5 Digital Console and two Control..
$25.00
Merry Christmas decal skin for PS5 Digital Console and two..
Merry Christmas decal skin for PS5 Digital Console and two..
$25.00
Merry Christmas decal skin for PS5 Digital Console and two..
Merry Christmas decal skin for PS5 Digital Console and two..
$25.00
Merry Christmas decal skin for PS5 Digital Console and two..
Merry Christmas decal skin for PS5 Digital Console and two..
$25.00
Merry Christmas decal skin for PS5 Digital Console and two..
Merry Christmas decal skin for PS5 Digital Console and two..
$25.00
Merry Christmas decal skin for PS5 Digital Console and two..
Merry Christmas decal skin for PS5 Digital Console and two..
$25.00
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i