Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
Croatia Croatia France France Hebrew Hebrew Hungary Hungary Vietnamese Vietnamese Greece Greece Czech Republic Czech Republic Denmark Denmark Romania Romania Finland Finland
$0.00
Xbox Series X skins
Xbox Series X Skin's Store Xbox Series X Skin's Store 2
Resident Evil Village decal skin for Xbox Series X Console..
Resident Evil Village decal skin for Xbox Series X Console..
$24.00
Resident Evil Village decal skin for Xbox Series X Console..
Resident Evil Village decal skin for Xbox Series X Console..
$24.00
Resident Evil 3 decal skin for Xbox Series X Console and 2..
Resident Evil 3 decal skin for Xbox Series X Console and 2..
$24.00
Resident Evil 3 decal skin for Xbox Series X Console and 2..
Resident Evil 3 decal skin for Xbox Series X Console and 2..
$24.00
Resident Evil 3 decal skin for Xbox Series X Console and 2..
Resident Evil 3 decal skin for Xbox Series X Console and 2..
$24.00
Resident Evil 3 decal skin for Xbox Series X Console and 2..
Resident Evil 3 decal skin for Xbox Series X Console and 2..
$24.00
Resident Evil 3 decal skin for Xbox Series X Console and 2..
Resident Evil 3 decal skin for Xbox Series X Console and 2..
$24.00
Resident Evil 3 decal skin for Xbox Series X Console and 2..
Resident Evil 3 decal skin for Xbox Series X Console and 2..
$24.00
Resident Evil 3 decal skin for Xbox Series X Console and 2..
Resident Evil 3 decal skin for Xbox Series X Console and 2..
$24.00
Resident Evil 3 decal skin for Xbox Series X Console and 2..
Resident Evil 3 decal skin for Xbox Series X Console and 2..
$24.00
Resident Evil 2 decal skin for Xbox Series X Console and 2..
Resident Evil 2 decal skin for Xbox Series X Console and 2..
$24.00
Resident Evil 2 decal skin for Xbox Series X Console and 2..
Resident Evil 2 decal skin for Xbox Series X Console and 2..
$24.00
Resident Evil 2 decal skin for Xbox Series X Console and 2..
Resident Evil 2 decal skin for Xbox Series X Console and 2..
$24.00
Resident Evil 2 decal skin for Xbox Series X Console and 2..
Resident Evil 2 decal skin for Xbox Series X Console and 2..
$24.00
Resident Evil 2 decal skin for Xbox Series X Console and 2..
Resident Evil 2 decal skin for Xbox Series X Console and 2..
$24.00
Resident Evil 2 decal skin for Xbox Series X Console and 2..
Resident Evil 2 decal skin for Xbox Series X Console and 2..
$24.00
Resident Evil 2 decal skin for Xbox Series X Console and 2..
Resident Evil 2 decal skin for Xbox Series X Console and 2..
$24.00
Resident Evil 2 decal skin for Xbox Series X Console and 2..
Resident Evil 2 decal skin for Xbox Series X Console and 2..
$24.00
Resident Evil 2 decal skin for Xbox Series X Console and 2..
Resident Evil 2 decal skin for Xbox Series X Console and 2..
$24.00
Star Wars Squadrons decal skin for Xbox Series X Console a..
Star Wars Squadrons decal skin for Xbox Series X Console a..
$24.00
Star Wars Squadrons decal skin for Xbox Series X Console a..
Star Wars Squadrons decal skin for Xbox Series X Console a..
$24.00
Star Wars Squadrons decal skin for Xbox Series X Console a..
Star Wars Squadrons decal skin for Xbox Series X Console a..
$24.00
Star Wars Stormtrooper decal skin for Xbox Series X Consol..
Star Wars Stormtrooper decal skin for Xbox Series X Consol..
$24.00
Star Wars Rogue Squadron decal skin for Xbox Series X Cons..
Star Wars Rogue Squadron decal skin for Xbox Series X Cons..
$24.00
Star Wars Squadrons decal skin for Xbox Series X Console a..
Star Wars Squadrons decal skin for Xbox Series X Console a..
$24.00
The Mandalorian decal skin for Xbox Series X Console and 2..
The Mandalorian decal skin for Xbox Series X Console and 2..
$24.00
The Mandalorian decal skin for Xbox Series X Console and 2..
The Mandalorian decal skin for Xbox Series X Console and 2..
$24.00
The Mandalorian decal skin for Xbox Series X Console and 2..
The Mandalorian decal skin for Xbox Series X Console and 2..
$24.00
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i