Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
Croatia Croatia France France Hebrew Hebrew Hungary Hungary Vietnamese Vietnamese Greece Greece Czech Republic Czech Republic Denmark Denmark Romania Romania Finland Finland
$0.00
Xbox One S skins
Xbox1 S Skin's store Xbox1 S Skin's store 2 Xbox1 S Skin's store 3 Xbox1 S Skin's store 4
Dallas Cowboys decal skin for Xbox one S Console and 2 Con..
Dallas Cowboys decal skin for Xbox one S Console and 2 Con..
$22.00
Dallas Cowboys decal skin for Xbox one S Console and 2 Con..
Dallas Cowboys decal skin for Xbox one S Console and 2 Con..
$22.00
Deadpool decal skin for Xbox one S Console and 2 Controllers
Deadpool decal skin for Xbox one S Console and 2 Controllers
$22.00
Deadpool decal skin for Xbox one S Console and 2 Controllers
Deadpool decal skin for Xbox one S Console and 2 Controllers
$22.00
Deadpool decal skin for Xbox one S Console and 2 Controllers
Deadpool decal skin for Xbox one S Console and 2 Controllers
$22.00
Deadpool decal skin for Xbox one S Console and 2 Controllers
Deadpool decal skin for Xbox one S Console and 2 Controllers
$22.00
Denver Broncos decal skin for Xbox one S Console and 2 Con..
Denver Broncos decal skin for Xbox one S Console and 2 Con..
$22.00
Denver Broncos decal skin for Xbox one S Console and 2 Con..
Denver Broncos decal skin for Xbox one S Console and 2 Con..
$22.00
Depths Of Hell Animated decal skin for Xbox one S Console ..
Depths Of Hell Animated decal skin for Xbox one S Console ..
$22.00
Detroit red wings decal skin for Xbox one S Console and 2 ..
Detroit red wings decal skin for Xbox one S Console and 2 ..
$22.00
Detroit Tigers decal skin for Xbox one S Console and 2 Con..
Detroit Tigers decal skin for Xbox one S Console and 2 Con..
$22.00
Deutschland decal skin for Xbox one S Console and 2 Contro..
Deutschland decal skin for Xbox one S Console and 2 Contro..
$22.00
Device interface decal skin for Xbox one S Console and 2 C..
Device interface decal skin for Xbox one S Console and 2 C..
$22.00
Devil scene decal skin for Xbox one S Console and 2 Contro..
Devil scene decal skin for Xbox one S Console and 2 Contro..
$22.00
Devil skull decal skin for Xbox one S Console and 2 Contro..
Devil skull decal skin for Xbox one S Console and 2 Contro..
$22.00
Devil skull decal skin for Xbox one S Console and 2 Contro..
Devil skull decal skin for Xbox one S Console and 2 Contro..
$22.00
Diamond Dogs decal skin for Xbox one S Console and 2 Contr..
Diamond Dogs decal skin for Xbox one S Console and 2 Contr..
$22.00
Dishonored 2 decal skin for Xbox one S Console and 2 Contr..
Dishonored 2 decal skin for Xbox one S Console and 2 Contr..
$22.00
Dishonored 2 decal skin for Xbox one S Console and 2 Contr..
Dishonored 2 decal skin for Xbox one S Console and 2 Contr..
$22.00
Dishonored 2 decal skin for Xbox one S Console and 2 Contr..
Dishonored 2 decal skin for Xbox one S Console and 2 Contr..
$22.00
Dishonored 2 decal skin for Xbox one S Console and 2 Contr..
Dishonored 2 decal skin for Xbox one S Console and 2 Contr..
$22.00
Dishonored2 decal skin for Xbox one S Console and 2 Contro..
Dishonored2 decal skin for Xbox one S Console and 2 Contro..
$22.00
Dollar papers decal skin for Xbox one S Console and 2 Cont..
Dollar papers decal skin for Xbox one S Console and 2 Cont..
$22.00
Dragon Ball Super decal skin for Xbox one S Console and 2 ..
Dragon Ball Super decal skin for Xbox one S Console and 2 ..
$22.00
Dragon Ball Super decal skin for Xbox one S Console and 2 ..
Dragon Ball Super decal skin for Xbox one S Console and 2 ..
$22.00
Dragon Ball Super decal skin for Xbox one S Console and 2 ..
Dragon Ball Super decal skin for Xbox one S Console and 2 ..
$22.00
Dragon Ball Xenoverse decal skin for Xbox one S Console an..
Dragon Ball Xenoverse decal skin for Xbox one S Console an..
$22.00
Dragon Ball Xenoverse decal skin for Xbox one S Console an..
Dragon Ball Xenoverse decal skin for Xbox one S Console an..
$22.00
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i