Product Added to your Cart
x

-------- OR --------

Default
CroatiaFranceHebrewHungaryVietnameseGreeceCzech RepublicDenmarkRomaniaFinland
USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Menu
0 items
Xbox1 S Skin's store
500 product(s) found for "Xbox1 S Skin's store"
The Birth of Venus decal ski..
Xbox1 S Skin's store
The Birth of Venus decal ski..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
Terraria decal skin for Xbox..
Xbox1 S Skin's store
Terraria decal skin for Xbox..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
Tech Wallpaper decal skin fo..
Xbox1 S Skin's store
Tech Wallpaper decal skin fo..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
Tech Wallpaper decal skin fo..
Xbox1 S Skin's store
Tech Wallpaper decal skin fo..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
Tech Wallpaper decal skin fo..
Xbox1 S Skin's store
Tech Wallpaper decal skin fo..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
Tech Wallpaper decal skin fo..
Xbox1 S Skin's store
Tech Wallpaper decal skin fo..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
Tech Wallpaper decal skin fo..
Xbox1 S Skin's store
Tech Wallpaper decal skin fo..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
Tech Wallpaper decal skin fo..
Xbox1 S Skin's store
Tech Wallpaper decal skin fo..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
Tech Wallpaper decal skin fo..
Xbox1 S Skin's store
Tech Wallpaper decal skin fo..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
Tech Wallpaper decal skin fo..
Xbox1 S Skin's store
Tech Wallpaper decal skin fo..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
Tech Wallpaper decal skin fo..
Xbox1 S Skin's store
Tech Wallpaper decal skin fo..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
Team Valor pokemon go decal ..
Xbox1 S Skin's store
Team Valor pokemon go decal ..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
Tartan wooden board decal sk..
Xbox1 S Skin's store
Tartan wooden board decal sk..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
Tar Heels North Carolina dec..
Xbox1 S Skin's store
Tar Heels North Carolina dec..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
Sword art online decal skin ..
Xbox1 S Skin's store
Sword art online decal skin ..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
Sword art online decal skin ..
Xbox1 S Skin's store
Sword art online decal skin ..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
Sword art online decal skin ..
Xbox1 S Skin's store
Sword art online decal skin ..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
Sword art online decal skin ..
Xbox1 S Skin's store
Sword art online decal skin ..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
Sword art online decal skin ..
Xbox1 S Skin's store
Sword art online decal skin ..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
Sword art online decal skin ..
Xbox1 S Skin's store
Sword art online decal skin ..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
Sword art online decal skin ..
Xbox1 S Skin's store
Sword art online decal skin ..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
Sword art online decal skin ..
Xbox1 S Skin's store
Sword art online decal skin ..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
Sword art online decal skin ..
Xbox1 S Skin's store
Sword art online decal skin ..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
Superman decal skin for Xbox..
Xbox1 S Skin's store
Superman decal skin for Xbox..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
Super Mario decal skin for X..
Xbox1 S Skin's store
Super Mario decal skin for X..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
Sunrise Painting decal skin ..
Xbox1 S Skin's store
Sunrise Painting decal skin ..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
Sunflower painting decal ski..
Xbox1 S Skin's store
Sunflower painting decal ski..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
Sun sets clipart decal skin ..
Xbox1 S Skin's store
Sun sets clipart decal skin ..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i