Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
Croatia Croatia France France Hebrew Hebrew Hungary Hungary Vietnamese Vietnamese Greece Greece Czech Republic Czech Republic Denmark Denmark Romania Romania Finland Finland
$0.00
Xbox1 S Skin's store 4
Rick and Morty decal skin for Xbox one S Console and 2 Con..
Rick and Morty decal skin for Xbox one S Console and 2 Con..
$22.00
Rick and Morty decal skin for Xbox one S Console and 2 Con..
Rick and Morty decal skin for Xbox one S Console and 2 Con..
$22.00
Rick and Morty decal skin for Xbox one S Console and 2 Con..
Rick and Morty decal skin for Xbox one S Console and 2 Con..
$22.00
Rick and Morty decal skin for Xbox one S Console and 2 Con..
Rick and Morty decal skin for Xbox one S Console and 2 Con..
$22.00
Rick and Morty decal skin for Xbox one S Console and 2 Con..
Rick and Morty decal skin for Xbox one S Console and 2 Con..
$22.00
Rick and Morty decal skin for Xbox one S Console and 2 Con..
Rick and Morty decal skin for Xbox one S Console and 2 Con..
$22.00
Retro Graphics decal skin for Xbox one S Console and 2 Con..
Retro Graphics decal skin for Xbox one S Console and 2 Con..
$22.00
Resident Evil 2 decal skin for Xbox one S Console and 2 Co..
Resident Evil 2 decal skin for Xbox one S Console and 2 Co..
$22.00
Resident Evil 2 decal skin for Xbox one S Console and 2 Co..
Resident Evil 2 decal skin for Xbox one S Console and 2 Co..
$22.00
Resident Evil 2 decal skin for Xbox one S Console and 2 Co..
Resident Evil 2 decal skin for Xbox one S Console and 2 Co..
$22.00
Resident Evil 2 decal skin for Xbox one S Console and 2 Co..
Resident Evil 2 decal skin for Xbox one S Console and 2 Co..
$22.00
Resident Evil 2 decal skin for Xbox one S Console and 2 Co..
Resident Evil 2 decal skin for Xbox one S Console and 2 Co..
$22.00
Resident Evil 2 decal skin for Xbox one S Console and 2 Co..
Resident Evil 2 decal skin for Xbox one S Console and 2 Co..
$22.00
Renacer decal skin for Xbox one S Console and 2 Controllers
Renacer decal skin for Xbox one S Console and 2 Controllers
$22.00
Red decal skin for Xbox one S Console and 2 Controllers
Red decal skin for Xbox one S Console and 2 Controllers
$22.00
Red Dead Redemption 2 decal skin for Xbox one S Console an..
Red Dead Redemption 2 decal skin for Xbox one S Console an..
$22.00
Red Dead Redemption 2 decal skin for Xbox one S Console an..
Red Dead Redemption 2 decal skin for Xbox one S Console an..
$22.00
Red Dead Redemption 2 decal skin for Xbox one S Console an..
Red Dead Redemption 2 decal skin for Xbox one S Console an..
$22.00
Red Dead Redemption 2 decal skin for Xbox one S Console an..
Red Dead Redemption 2 decal skin for Xbox one S Console an..
$22.00
Red Dead Redemption 2 decal skin for Xbox one S Console an..
Red Dead Redemption 2 decal skin for Xbox one S Console an..
$22.00
Red Dead Redemption 2 decal skin for Xbox one S Console an..
Red Dead Redemption 2 decal skin for Xbox one S Console an..
$22.00
Red Dead Redemption 2 decal skin for Xbox one S Console an..
Red Dead Redemption 2 decal skin for Xbox one S Console an..
$22.00
Red Dead Redemption 2 decal skin for Xbox one S Console an..
Red Dead Redemption 2 decal skin for Xbox one S Console an..
$22.00
Red Dead Redemption 2 decal skin for Xbox one S Console an..
Red Dead Redemption 2 decal skin for Xbox one S Console an..
$22.00
Red Dead Redemption 2 decal skin for Xbox one S Console an..
Red Dead Redemption 2 decal skin for Xbox one S Console an..
$22.00
Red Dead Redemption 2 decal skin for Xbox one S Console an..
Red Dead Redemption 2 decal skin for Xbox one S Console an..
$22.00
Red Dead Redemption 2 decal skin for Xbox one S Console an..
Red Dead Redemption 2 decal skin for Xbox one S Console an..
$22.00
Red Dead Redemption 2 decal skin for Xbox one S Console an..
Red Dead Redemption 2 decal skin for Xbox one S Console an..
$22.00
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i