Product Added to your Cart
x

-------- OR --------

Default
CroatiaFranceHebrewHungaryVietnameseGreeceCzech RepublicDenmarkRomaniaFinland
USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Menu
0 items
Xbox Skins Store
Sub-Categories
Xbox1 Skins StoreXbox1 Skins Store 2Xbox1 Skins Store 3Xbox1 Skins Store 4Xbox1 Skins Store 5
500 product(s) found for "Xbox Skins Store"
Watch dogs 2 decal skin for ..
Xbox Skins Store
Watch dogs 2 decal skin for ..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
Mafia 3 the black mob decal ..
Xbox Skins Store
Mafia 3 the black mob decal ..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
Mafia 3 the black mob decal ..
Xbox Skins Store
Mafia 3 the black mob decal ..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
Mafia 3 the black mob decal ..
Xbox Skins Store
Mafia 3 the black mob decal ..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
Star wars the force awakens ..
Xbox Skins Store
Star wars the force awakens ..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
Star wars the force awakens ..
Xbox Skins Store
Star wars the force awakens ..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
Star wars decal skin for Xbo..
Xbox Skins Store
Star wars decal skin for Xbo..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
James 23 cleveland cavaliers..
Xbox Skins Store
James 23 cleveland cavaliers..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
James 23 cleveland cavaliers..
Xbox Skins Store
James 23 cleveland cavaliers..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
James 23 cleveland cavaliers..
Xbox Skins Store
James 23 cleveland cavaliers..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
Tennessee Titans decal skin ..
Xbox Skins Store
Tennessee Titans decal skin ..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
Wooden Board decal skin for ..
Xbox Skins Store
Wooden Board decal skin for ..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
FC Barcelona decal skin for ..
Xbox Skins Store
FC Barcelona decal skin for ..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
Mafia decal skin for Xbox on..
Xbox Skins Store
Mafia decal skin for Xbox on..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
Winter is coming stark decal..
Xbox Skins Store
Winter is coming stark decal..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
Blurry uk flag decal skin fo..
Xbox Skins Store
Blurry uk flag decal skin fo..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
Manchester united decal skin..
Xbox Skins Store
Manchester united decal skin..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
Nude girl decal skin for Xbo..
Xbox Skins Store
Nude girl decal skin for Xbo..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
Dragon ball super vegeta dec..
Xbox Skins Store
Dragon ball super vegeta dec..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
Dragon ball super son goku d..
Xbox Skins Store
Dragon ball super son goku d..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
Dark souls 3 decal skin for ..
Xbox Skins Store
Dark souls 3 decal skin for ..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
Anime girl decal skin for Xb..
Xbox Skins Store
Anime girl decal skin for Xb..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
Thunder lightings decal skin..
Xbox Skins Store
Thunder lightings decal skin..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
Call of duty black ops decal..
Xbox Skins Store
Call of duty black ops decal..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
Harley quinn decal skin for ..
Xbox Skins Store
Harley quinn decal skin for ..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
Sunderland afc decal skin fo..
Xbox Skins Store
Sunderland afc decal skin fo..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
Sunderland afc decal skin fo..
Xbox Skins Store
Sunderland afc decal skin fo..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
Sunderland afc decal skin fo..
Xbox Skins Store
Sunderland afc decal skin fo..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i