Product Added to your Cart
x

-------- OR --------

Default
CroatiaFranceHebrewHungaryVietnameseGreeceCzech RepublicDenmarkRomaniaFinland
USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Menu
0 items
Xbox1 Skins Store 2
500 product(s) found for "Xbox1 Skins Store 2"
Metro Last Light decal skin ..
Xbox1 Skins Store 2
Metro Last Light decal skin ..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
Marvel Iron Man decal skin f..
Xbox1 Skins Store 2
Marvel Iron Man decal skin f..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
Manga Anime Print decal skin..
Xbox1 Skins Store 2
Manga Anime Print decal skin..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
Madden 18 decal skin for Xb..
Xbox1 Skins Store 2
Madden 18 decal skin for Xb..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
Los Angeles Lakers decal ski..
Xbox1 Skins Store 2
Los Angeles Lakers decal ski..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
LocoRoco 2 decal skin for Xb..
Xbox1 Skins Store 2
LocoRoco 2 decal skin for Xb..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
LocoRoco 2 decal skin for Xb..
Xbox1 Skins Store 2
LocoRoco 2 decal skin for Xb..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
LocoRoco decal skin for Xbo..
Xbox1 Skins Store 2
LocoRoco decal skin for Xbo..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
Lightning sky with nature vi..
Xbox1 Skins Store 2
Lightning sky with nature vi..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
Lightning sky decal skin fo..
Xbox1 Skins Store 2
Lightning sky decal skin fo..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
Lightning sky decal skin fo..
Xbox1 Skins Store 2
Lightning sky decal skin fo..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
Lightning sky decal skin fo..
Xbox1 Skins Store 2
Lightning sky decal skin fo..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
Lightning sky decal skin fo..
Xbox1 Skins Store 2
Lightning sky decal skin fo..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
Lightning Galaxy decal skin ..
Xbox1 Skins Store 2
Lightning Galaxy decal skin ..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
Lightning cloudy sky with ro..
Xbox1 Skins Store 2
Lightning cloudy sky with ro..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
Lightning cloudy sky decal s..
Xbox1 Skins Store 2
Lightning cloudy sky decal s..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
Lightning cloudy sky decal s..
Xbox1 Skins Store 2
Lightning cloudy sky decal s..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
Lightning cloudy sky decal s..
Xbox1 Skins Store 2
Lightning cloudy sky decal s..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
Lightning cloudy sky decal s..
Xbox1 Skins Store 2
Lightning cloudy sky decal s..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
Lightning cloudy sky decal s..
Xbox1 Skins Store 2
Lightning cloudy sky decal s..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
Lightning cloudy sky decal s..
Xbox1 Skins Store 2
Lightning cloudy sky decal s..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
Lightning cloudy sky decal s..
Xbox1 Skins Store 2
Lightning cloudy sky decal s..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
Lightning cloudy sky decal s..
Xbox1 Skins Store 2
Lightning cloudy sky decal s..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
Lightning cloudy sky decal s..
Xbox1 Skins Store 2
Lightning cloudy sky decal s..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
Lightning cloudy sky decal s..
Xbox1 Skins Store 2
Lightning cloudy sky decal s..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
Lightning Bolt decal skin f..
Xbox1 Skins Store 2
Lightning Bolt decal skin f..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
Lightning decal skin for Xb..
Xbox1 Skins Store 2
Lightning decal skin for Xb..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
Light Blue Carbon Fiber deca..
Xbox1 Skins Store 2
Light Blue Carbon Fiber deca..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i