Product Added to your Cart
x

-------- OR --------

Default
CroatiaFranceHebrewHungaryVietnameseGreeceCzech RepublicDenmarkRomaniaFinland
USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Menu
0 items
Xbox1 Skins Store 3
500 product(s) found for "Xbox1 Skins Store 3"
Tech Wallpaper decal skin fo..
Xbox1 Skins Store 3
Tech Wallpaper decal skin fo..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
Swan Wallpaper decal skin fo..
Xbox1 Skins Store 3
Swan Wallpaper decal skin fo..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
Super Heroes decal skin for ..
Xbox1 Skins Store 3
Super Heroes decal skin for ..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
Sticker bomb decal skin for ..
Xbox1 Skins Store 3
Sticker bomb decal skin for ..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
State of Decay 2 decal skin ..
Xbox1 Skins Store 3
State of Decay 2 decal skin ..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
State of Decay 2 decal skin ..
Xbox1 Skins Store 3
State of Decay 2 decal skin ..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
State of Decay 2 decal skin ..
Xbox1 Skins Store 3
State of Decay 2 decal skin ..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
State of Decay 2 decal skin ..
Xbox1 Skins Store 3
State of Decay 2 decal skin ..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
State of Decay 2 decal skin ..
Xbox1 Skins Store 3
State of Decay 2 decal skin ..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
State of Decay 2 decal skin ..
Xbox1 Skins Store 3
State of Decay 2 decal skin ..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
State of Decay 2 decal skin ..
Xbox1 Skins Store 3
State of Decay 2 decal skin ..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
State of Decay 2 decal skin ..
Xbox1 Skins Store 3
State of Decay 2 decal skin ..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
State of Decay 2 decal skin ..
Xbox1 Skins Store 3
State of Decay 2 decal skin ..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
State of Decay 2 decal skin ..
Xbox1 Skins Store 3
State of Decay 2 decal skin ..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
Starfield decal skin for Xbo..
Xbox1 Skins Store 3
Starfield decal skin for Xbo..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
Starfield decal skin for Xbo..
Xbox1 Skins Store 3
Starfield decal skin for Xbo..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
Starfield decal skin for Xbo..
Xbox1 Skins Store 3
Starfield decal skin for Xbo..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
Star Wars SOLO decal skin fo..
Xbox1 Skins Store 3
Star Wars SOLO decal skin fo..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
Spider Man decal skin for Xb..
Xbox1 Skins Store 3
Spider Man decal skin for Xb..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
Spider Man decal skin for Xb..
Xbox1 Skins Store 3
Spider Man decal skin for Xb..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
Spider Man decal skin for Xb..
Xbox1 Skins Store 3
Spider Man decal skin for Xb..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
Spider Man decal skin for Xb..
Xbox1 Skins Store 3
Spider Man decal skin for Xb..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
Spider Man decal skin for Xb..
Xbox1 Skins Store 3
Spider Man decal skin for Xb..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
Spain National FT decal skin..
Xbox1 Skins Store 3
Spain National FT decal skin..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
Spain National FT decal skin..
Xbox1 Skins Store 3
Spain National FT decal skin..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
Smosh decal skin for Xbox on..
Xbox1 Skins Store 3
Smosh decal skin for Xbox on..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
Sky Wallpaper decal skin for..
Xbox1 Skins Store 3
Sky Wallpaper decal skin for..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
Shining water decal skin for..
Xbox1 Skins Store 3
Shining water decal skin for..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i