Product Added to your Cart
x

-------- OR --------

Default
CroatiaFranceHebrewHungaryVietnameseGreeceCzech RepublicDenmarkRomaniaFinland
USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Menu
0 items
Xbox1 Skins Store 4
500 product(s) found for "Xbox1 Skins Store 4"
Miami Marlins decal skin for..
Xbox1 Skins Store 4
Miami Marlins decal skin for..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
Metro Exodus decal skin for ..
Xbox1 Skins Store 4
Metro Exodus decal skin for ..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
Metro Exodus decal skin for ..
Xbox1 Skins Store 4
Metro Exodus decal skin for ..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
Metro Exodus decal skin for ..
Xbox1 Skins Store 4
Metro Exodus decal skin for ..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
Metro Exodus decal skin for ..
Xbox1 Skins Store 4
Metro Exodus decal skin for ..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
Metro Exodus decal skin for ..
Xbox1 Skins Store 4
Metro Exodus decal skin for ..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
Metro Exodus decal skin for ..
Xbox1 Skins Store 4
Metro Exodus decal skin for ..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
Metro Exodus decal skin for ..
Xbox1 Skins Store 4
Metro Exodus decal skin for ..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
Metro Exodus decal skin for ..
Xbox1 Skins Store 4
Metro Exodus decal skin for ..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
Metro Exodus decal skin for ..
Xbox1 Skins Store 4
Metro Exodus decal skin for ..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
Metro Exodus
Xbox1 Skins Store 4
Metro Exodus
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
Metro Exodus
Xbox1 Skins Store 4
Metro Exodus
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
Melissa mccracken decal skin..
Xbox1 Skins Store 4
Melissa mccracken decal skin..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
Marilyn Monroe decal skin fo..
Xbox1 Skins Store 4
Marilyn Monroe decal skin fo..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
Manchester United decal skin..
Xbox1 Skins Store 4
Manchester United decal skin..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
Manchester City decal skin f..
Xbox1 Skins Store 4
Manchester City decal skin f..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
Los Angeles Lakers decal ski..
Xbox1 Skins Store 4
Los Angeles Lakers decal ski..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
Los Angeles Lakers decal ski..
Xbox1 Skins Store 4
Los Angeles Lakers decal ski..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
Lady Face decal skin for Xbo..
Xbox1 Skins Store 4
Lady Face decal skin for Xbo..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
Kingdom Hearts decal skin fo..
Xbox1 Skins Store 4
Kingdom Hearts decal skin fo..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
Kingdom Hearts 3 decal skin ..
Xbox1 Skins Store 4
Kingdom Hearts 3 decal skin ..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
Kingdom Hearts 3 decal skin ..
Xbox1 Skins Store 4
Kingdom Hearts 3 decal skin ..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
Kingdom Hearts 3 decal skin ..
Xbox1 Skins Store 4
Kingdom Hearts 3 decal skin ..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
Kingdom Hearts 3 decal skin ..
Xbox1 Skins Store 4
Kingdom Hearts 3 decal skin ..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
Kingdom Hearts 3 decal skin ..
Xbox1 Skins Store 4
Kingdom Hearts 3 decal skin ..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
Kingdom Hearts 3 decal skin ..
Xbox1 Skins Store 4
Kingdom Hearts 3 decal skin ..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
Kingdom Hearts 3 decal skin ..
Xbox1 Skins Store 4
Kingdom Hearts 3 decal skin ..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
Kingdom Hearts 3 decal skin ..
Xbox1 Skins Store 4
Kingdom Hearts 3 decal skin ..
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
$22.00
Units in Stock: 999
$22.00
Details
Add To Cart
Colorful, High Quality, ""Anti-Slip"" Long Lasting Sticker Fits with Microsoft Xbox one S Next-Gen Console & 2 Dualshock Controllers Precision Cut, Easy Access for Buttons, Controls & Connectors. Easy...
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i