Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
Croatia Croatia France France Hebrew Hebrew Hungary Hungary Vietnamese Vietnamese Greece Greece Czech Republic Czech Republic Denmark Denmark Romania Romania Finland Finland
$0.00
Xbox1 Skins Store 5
WarFrame decal skin for Xbox one Console and 2 Controllers
WarFrame decal skin for Xbox one Console and 2 Controllers
$22.00
WarFrame decal skin for Xbox one Console and 2 Controllers
WarFrame decal skin for Xbox one Console and 2 Controllers
$22.00
WarFrame decal skin for Xbox one Console and 2 Controllers
WarFrame decal skin for Xbox one Console and 2 Controllers
$22.00
Watch Dogs legion decal skin for Xbox one Console and 2 Co..
Watch Dogs legion decal skin for Xbox one Console and 2 Co..
$22.00
Watch Dogs legion decal skin for Xbox one Console and 2 Co..
Watch Dogs legion decal skin for Xbox one Console and 2 Co..
$22.00
Watch Dogs legion decal skin for Xbox one Console and 2 Co..
Watch Dogs legion decal skin for Xbox one Console and 2 Co..
$22.00
Watch Dogs legion decal skin for Xbox one Console and 2 Co..
Watch Dogs legion decal skin for Xbox one Console and 2 Co..
$22.00
Watch Dogs legion decal skin for Xbox one Console and 2 Co..
Watch Dogs legion decal skin for Xbox one Console and 2 Co..
$22.00
Watch Dogs legion decal skin for Xbox one Console and 2 Co..
Watch Dogs legion decal skin for Xbox one Console and 2 Co..
$22.00
Watch Dogs legion decal skin for Xbox one Console and 2 Co..
Watch Dogs legion decal skin for Xbox one Console and 2 Co..
$22.00
Weed Leaf decal skin for Xbox one Console and 2 Controllers
Weed Leaf decal skin for Xbox one Console and 2 Controllers
$22.00
Weed Leaf decal skin for Xbox one Console and 2 Controllers
Weed Leaf decal skin for Xbox one Console and 2 Controllers
$22.00
Wolf decal skin for Xbox one Console and 2 Controllers
Wolf decal skin for Xbox one Console and 2 Controllers
$22.00
Wolfenstein Youngblood decal skin for Xbox one Console and..
Wolfenstein Youngblood decal skin for Xbox one Console and..
$22.00
Wolfenstein Youngblood decal skin for Xbox one Console and..
Wolfenstein Youngblood decal skin for Xbox one Console and..
$22.00
Wonder Woman decal skin for Xbox one Console and 2 Control..
Wonder Woman decal skin for Xbox one Console and 2 Control..
$22.00
Wonder Woman decal skin for Xbox one Console and 2 Control..
Wonder Woman decal skin for Xbox one Console and 2 Control..
$22.00
Wooden Board decal skin for Xbox one Console and 2 Control..
Wooden Board decal skin for Xbox one Console and 2 Control..
$22.00
Wooden Board decal skin for Xbox one Console and 2 Control..
Wooden Board decal skin for Xbox one Console and 2 Control..
$22.00
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i