Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
Croatia Croatia France France Hebrew Hebrew Hungary Hungary Vietnamese Vietnamese Greece Greece Czech Republic Czech Republic Denmark Denmark Romania Romania Finland Finland
$0.00
Xbox One X skins
Xbox1 X Skin's store Xbox1 X Skin's store 2 Xbox1 X Skin's store 3 Xbox1 X Skin's store 4 Xbox1 X Skin's store 5
Grand Theft Auto V decal skin for Xbox one X Console and 2..
Grand Theft Auto V decal skin for Xbox one X Console and 2..
$23.00
Grand Theft Auto V decal skin for Xbox one X Console and 2..
Grand Theft Auto V decal skin for Xbox one X Console and 2..
$23.00
Grand Theft Auto V decal skin for Xbox one X Console and 2..
Grand Theft Auto V decal skin for Xbox one X Console and 2..
$23.00
Grand Theft Auto V decal skin for Xbox one X Console and 2..
Grand Theft Auto V decal skin for Xbox one X Console and 2..
$23.00
Grand Theft Auto V decal skin for Xbox one X Console and 2..
Grand Theft Auto V decal skin for Xbox one X Console and 2..
$23.00
Grand Theft Auto V decal skin for Xbox one X Console and 2..
Grand Theft Auto V decal skin for Xbox one X Console and 2..
$23.00
Graffiti decal skin for Xbox one X Console and 2 Controllers
Graffiti decal skin for Xbox one X Console and 2 Controllers
$23.00
Graffiti decal skin for Xbox one X Console and 2 Controllers
Graffiti decal skin for Xbox one X Console and 2 Controllers
$23.00
Graffiti decal skin for Xbox one X Console and 2 Controllers
Graffiti decal skin for Xbox one X Console and 2 Controllers
$23.00
Graffiti decal skin for Xbox one X Console and 2 Controllers
Graffiti decal skin for Xbox one X Console and 2 Controllers
$23.00
Graffiti decal skin for Xbox one X Console and 2 Controllers
Graffiti decal skin for Xbox one X Console and 2 Controllers
$23.00
Graffiti decal skin for Xbox one X Console and 2 Controllers
Graffiti decal skin for Xbox one X Console and 2 Controllers
$23.00
Graffiti decal skin for Xbox one X Console and 2 Controllers
Graffiti decal skin for Xbox one X Console and 2 Controllers
$23.00
Golden wrapping paper texture decal skin for Xbox one X Co..
Golden wrapping paper texture decal skin for Xbox one X Co..
$23.00
Golden State Warriors decal skin for Xbox one X Console an..
Golden State Warriors decal skin for Xbox one X Console an..
$23.00
Golden State Warriors decal skin for Xbox one X Console an..
Golden State Warriors decal skin for Xbox one X Console an..
$23.00
Golden State Warriors decal skin for Xbox one X Console an..
Golden State Warriors decal skin for Xbox one X Console an..
$23.00
Golden State Warriors decal skin for Xbox one X Console an..
Golden State Warriors decal skin for Xbox one X Console an..
$23.00
Golden State Warriors decal skin for Xbox one X Console an..
Golden State Warriors decal skin for Xbox one X Console an..
$23.00
Golden State Warriors decal skin for Xbox one X Console an..
Golden State Warriors decal skin for Xbox one X Console an..
$23.00
Golden State Warriors decal skin for Xbox one X Console an..
Golden State Warriors decal skin for Xbox one X Console an..
$23.00
Golden State Warriors decal skin for Xbox one X Console an..
Golden State Warriors decal skin for Xbox one X Console an..
$23.00
Golden State Warriors decal skin for Xbox one X Console an..
Golden State Warriors decal skin for Xbox one X Console an..
$23.00
Golden State Warriors decal skin for Xbox one X Console an..
Golden State Warriors decal skin for Xbox one X Console an..
$23.00
Goku decal skin for Xbox one X Console and 2 Controllers
Goku decal skin for Xbox one X Console and 2 Controllers
$23.00
Goku decal skin for Xbox one X Console and 2 Controllers
Goku decal skin for Xbox one X Console and 2 Controllers
$23.00
God of War 3 decal skin for Xbox one X Console and 2 Contr..
God of War 3 decal skin for Xbox one X Console and 2 Contr..
$23.00
Gears of war decal skin for Xbox one X Console and 2 Contr..
Gears of war decal skin for Xbox one X Console and 2 Contr..
$23.00
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i