Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
Croatia Croatia France France Hebrew Hebrew Hungary Hungary Vietnamese Vietnamese Greece Greece Czech Republic Czech Republic Denmark Denmark Romania Romania Finland Finland
$0.00
Xbox One X skins
Xbox1 X Skin's store Xbox1 X Skin's store 2 Xbox1 X Skin's store 3 Xbox1 X Skin's store 4 Xbox1 X Skin's store 5
Dragon Ball Z Super decal skin for Xbox one X Console and ..
Dragon Ball Z Super decal skin for Xbox one X Console and ..
$23.00
Dragon Ball Z decal skin for Xbox one X Console and 2 Cont..
Dragon Ball Z decal skin for Xbox one X Console and 2 Cont..
$23.00
Michael Jordan decal skin for Xbox one X Console and 2 Con..
Michael Jordan decal skin for Xbox one X Console and 2 Con..
$23.00
Star Wars decal skin for Xbox one X Console and 2 Controll..
Star Wars decal skin for Xbox one X Console and 2 Controll..
$23.00
Eat sleep jdm domo decal skin for Xbox one X Console and 2..
Eat sleep jdm domo decal skin for Xbox one X Console and 2..
$23.00
Star Wars decal skin for Xbox one X Console and 2 Controll..
Star Wars decal skin for Xbox one X Console and 2 Controll..
$23.00
Dragon Ball Z Super decal skin for Xbox one X Console and ..
Dragon Ball Z Super decal skin for Xbox one X Console and ..
$23.00
Grand Theft Auto V decal skin for Xbox one X Console and 2..
Grand Theft Auto V decal skin for Xbox one X Console and 2..
$23.00
Grand Theft Auto V decal skin for Xbox one X Console and 2..
Grand Theft Auto V decal skin for Xbox one X Console and 2..
$23.00
Grand Theft Auto V decal skin for Xbox one X Console and 2..
Grand Theft Auto V decal skin for Xbox one X Console and 2..
$23.00
Grand Theft Auto V decal skin for Xbox one X Console and 2..
Grand Theft Auto V decal skin for Xbox one X Console and 2..
$23.00
Grand Theft Auto V decal skin for Xbox one X Console and 2..
Grand Theft Auto V decal skin for Xbox one X Console and 2..
$23.00
Grand Theft Auto V decal skin for Xbox one X Console and 2..
Grand Theft Auto V decal skin for Xbox one X Console and 2..
$23.00
Leroy Neiman Michael Jordan Painting decal skin for Xbox o..
Leroy Neiman Michael Jordan Painting decal skin for Xbox o..
$23.00
Stone Wall decal skin for Xbox one X Console and 2 Control..
Stone Wall decal skin for Xbox one X Console and 2 Control..
$23.00
Eat sleep jdm domo decal skin for Xbox one X Console and 2..
Eat sleep jdm domo decal skin for Xbox one X Console and 2..
$23.00
Cartoon graffiti decal skin for Xbox one X Console and 2 C..
Cartoon graffiti decal skin for Xbox one X Console and 2 C..
$23.00
Graffiti decal skin for Xbox one X Console and 2 Controllers
Graffiti decal skin for Xbox one X Console and 2 Controllers
$23.00
Eat sleep jdm domo decal skin for Xbox one X Console and 2..
Eat sleep jdm domo decal skin for Xbox one X Console and 2..
$23.00
Eat sleep jdm domo decal skin for Xbox one X Console and 2..
Eat sleep jdm domo decal skin for Xbox one X Console and 2..
$23.00
Stone Wall decal skin for Xbox one X Console and 2 Control..
Stone Wall decal skin for Xbox one X Console and 2 Control..
$23.00
Rusted stone wall decal skin for Xbox one X Console and 2 ..
Rusted stone wall decal skin for Xbox one X Console and 2 ..
$23.00
Graffiti decal skin for Xbox one X Console and 2 Controllers
Graffiti decal skin for Xbox one X Console and 2 Controllers
$23.00
Multicolor Stone Wall decal skin for Xbox one X Console an..
Multicolor Stone Wall decal skin for Xbox one X Console an..
$23.00
Black and White Brick wall decal skin for Xbox one X Conso..
Black and White Brick wall decal skin for Xbox one X Conso..
$23.00
Rusted Brick Wall decal skin for Xbox one X Console and 2 ..
Rusted Brick Wall decal skin for Xbox one X Console and 2 ..
$23.00
Broken Rusted Brick Wall decal skin for Xbox one X Console..
Broken Rusted Brick Wall decal skin for Xbox one X Console..
$23.00
Broken Rusted Brick Wall decal skin for Xbox one X Console..
Broken Rusted Brick Wall decal skin for Xbox one X Console..
$23.00
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i