Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
Croatia Croatia France France Hebrew Hebrew Hungary Hungary Vietnamese Vietnamese Greece Greece Czech Republic Czech Republic Denmark Denmark Romania Romania Finland Finland
$0.00
Xbox One X skins
Xbox1 X Skin's store Xbox1 X Skin's store 2 Xbox1 X Skin's store 3 Xbox1 X Skin's store 4 Xbox1 X Skin's store 5
Rusted stone wall decal skin for Xbox one X Console and 2 ..
Rusted stone wall decal skin for Xbox one X Console and 2 ..
$23.00
Graffiti decal skin for Xbox one X Console and 2 Controllers
Graffiti decal skin for Xbox one X Console and 2 Controllers
$23.00
Eat sleep jdm domo decal skin for Xbox one X Console and 2..
Eat sleep jdm domo decal skin for Xbox one X Console and 2..
$23.00
Cartoon sticker bomb decal skin for Xbox one X Console and..
Cartoon sticker bomb decal skin for Xbox one X Console and..
$23.00
Graffiti decal skin for Xbox one X Console and 2 Controllers
Graffiti decal skin for Xbox one X Console and 2 Controllers
$23.00
Emoji stikers decal skin for Xbox one X Console and 2 Cont..
Emoji stikers decal skin for Xbox one X Console and 2 Cont..
$23.00
Eat sleep jdm domo decal skin for Xbox one X Console and 2..
Eat sleep jdm domo decal skin for Xbox one X Console and 2..
$23.00
Stone Wall decal skin for Xbox one X Console and 2 Control..
Stone Wall decal skin for Xbox one X Console and 2 Control..
$23.00
Rusted stone wall decal skin for Xbox one X Console and 2 ..
Rusted stone wall decal skin for Xbox one X Console and 2 ..
$23.00
Funky Graffiti decal skin for Xbox one X Console and 2 Con..
Funky Graffiti decal skin for Xbox one X Console and 2 Con..
$23.00
Brick wall Design decal skin for Xbox one X Console and 2 ..
Brick wall Design decal skin for Xbox one X Console and 2 ..
$23.00
Colourful brick wall paint decal skin for Xbox one X Conso..
Colourful brick wall paint decal skin for Xbox one X Conso..
$23.00
Brick wall decal skin for Xbox one X Console and 2 Control..
Brick wall decal skin for Xbox one X Console and 2 Control..
$23.00
Pollution masked decal skin for Xbox one X Console and 2 C..
Pollution masked decal skin for Xbox one X Console and 2 C..
$23.00
Brick wall decal skin for Xbox one X Console and 2 Control..
Brick wall decal skin for Xbox one X Console and 2 Control..
$23.00
Colorful anime decal skin for Xbox one X Console and 2 Con..
Colorful anime decal skin for Xbox one X Console and 2 Con..
$23.00
Colorful skull decal skin for Xbox one X Console and 2 Con..
Colorful skull decal skin for Xbox one X Console and 2 Con..
$23.00
Wall Graffiti decal skin for Xbox one X Console and 2 Cont..
Wall Graffiti decal skin for Xbox one X Console and 2 Cont..
$23.00
Nba street Graffiti decal skin for Xbox one X Console and ..
Nba street Graffiti decal skin for Xbox one X Console and ..
$23.00
Michael jordan leroy neiman decal skin for Xbox one X Cons..
Michael jordan leroy neiman decal skin for Xbox one X Cons..
$23.00
Rusted and Broken Brick wall decal skin for Xbox one X Con..
Rusted and Broken Brick wall decal skin for Xbox one X Con..
$23.00
Brick wall decal skin for Xbox one X Console and 2 Control..
Brick wall decal skin for Xbox one X Console and 2 Control..
$23.00
Brick wall print decal skin for Xbox one X Console and 2 C..
Brick wall print decal skin for Xbox one X Console and 2 C..
$23.00
Colourful brick wall print decal skin for Xbox one X Conso..
Colourful brick wall print decal skin for Xbox one X Conso..
$23.00
Multicolour brick wall print decal skin for Xbox one X Con..
Multicolour brick wall print decal skin for Xbox one X Con..
$23.00
Colourful retro robots decal skin for Xbox one X Console a..
Colourful retro robots decal skin for Xbox one X Console a..
$23.00
Acid trip decal skin for Xbox one X Console and 2 Controll..
Acid trip decal skin for Xbox one X Console and 2 Controll..
$23.00
Graffiti decal skin for Xbox one X Console and 2 Controllers
Graffiti decal skin for Xbox one X Console and 2 Controllers
$23.00
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i