Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Default
Croatia Croatia France France Hebrew Hebrew Hungary Hungary Vietnamese Vietnamese Greece Greece Czech Republic Czech Republic Denmark Denmark Romania Romania Finland Finland
$0.00
Xbox One X skins
Xbox1 X Skin's store Xbox1 X Skin's store 2 Xbox1 X Skin's store 3 Xbox1 X Skin's store 4 Xbox1 X Skin's store 5
Flower painting decal skin for Xbox one X Console and 2 Co..
Flower painting decal skin for Xbox one X Console and 2 Co..
$23.00
Fondos de pantalla hd collage decal skin for Xbox one X Co..
Fondos de pantalla hd collage decal skin for Xbox one X Co..
$23.00
Fondos de pantalla hd collage decal skin for Xbox one X Co..
Fondos de pantalla hd collage decal skin for Xbox one X Co..
$23.00
Forza Motorsport 7 decal skin for Xbox one X Console and 2..
Forza Motorsport 7 decal skin for Xbox one X Console and 2..
$23.00
Forza Motorsport 7 decal skin for Xbox one X Console and 2..
Forza Motorsport 7 decal skin for Xbox one X Console and 2..
$23.00
Forza Motorsport 7 decal skin for Xbox one X Console and 2..
Forza Motorsport 7 decal skin for Xbox one X Console and 2..
$23.00
Forza Motorsport 7 GTR decal skin for Xbox one X Console a..
Forza Motorsport 7 GTR decal skin for Xbox one X Console a..
$23.00
Fox Tail decal skin for Xbox one X Console and 2 Controllers
Fox Tail decal skin for Xbox one X Console and 2 Controllers
$23.00
Funky Graffiti decal skin for Xbox one X Console and 2 Con..
Funky Graffiti decal skin for Xbox one X Console and 2 Con..
$23.00
Galaxy Blackhole decal skin for Xbox one X Console and 2 C..
Galaxy Blackhole decal skin for Xbox one X Console and 2 C..
$23.00
Galaxy decal skin for Xbox one X Console and 2 Controllers
Galaxy decal skin for Xbox one X Console and 2 Controllers
$23.00
Galaxy decal skin for Xbox one X Console and 2 Controllers
Galaxy decal skin for Xbox one X Console and 2 Controllers
$23.00
Galaxy with Stars decal skin for Xbox one X Console and 2 ..
Galaxy with Stars decal skin for Xbox one X Console and 2 ..
$23.00
Galaxy with Stars decal skin for Xbox one X Console and 2 ..
Galaxy with Stars decal skin for Xbox one X Console and 2 ..
$23.00
Galaxy with Stars decal skin for Xbox one X Console and 2 ..
Galaxy with Stars decal skin for Xbox one X Console and 2 ..
$23.00
Galaxy with Stars decal skin for Xbox one X Console and 2 ..
Galaxy with Stars decal skin for Xbox one X Console and 2 ..
$23.00
Galaxy with Stars decal skin for Xbox one X Console and 2 ..
Galaxy with Stars decal skin for Xbox one X Console and 2 ..
$23.00
Galaxy with Stars decal skin for Xbox one X Console and 2 ..
Galaxy with Stars decal skin for Xbox one X Console and 2 ..
$23.00
Galaxy with Stars decal skin for Xbox one X Console and 2 ..
Galaxy with Stars decal skin for Xbox one X Console and 2 ..
$23.00
Galaxy with Stars decal skin for Xbox one X Console and 2 ..
Galaxy with Stars decal skin for Xbox one X Console and 2 ..
$23.00
Galaxy with Stars decal skin for Xbox one X Console and 2 ..
Galaxy with Stars decal skin for Xbox one X Console and 2 ..
$23.00
Galaxy with Stars decal skin for Xbox one X Console and 2 ..
Galaxy with Stars decal skin for Xbox one X Console and 2 ..
$23.00
Galaxy with Stars decal skin for Xbox one X Console and 2 ..
Galaxy with Stars decal skin for Xbox one X Console and 2 ..
$23.00
Galaxy with Stars decal skin for Xbox one X Console and 2 ..
Galaxy with Stars decal skin for Xbox one X Console and 2 ..
$23.00
Gears of war decal skin for Xbox one X Console and 2 Contr..
Gears of war decal skin for Xbox one X Console and 2 Contr..
$23.00
God of War 3 decal skin for Xbox one X Console and 2 Contr..
God of War 3 decal skin for Xbox one X Console and 2 Contr..
$23.00
Goku decal skin for Xbox one X Console and 2 Controllers
Goku decal skin for Xbox one X Console and 2 Controllers
$23.00
Goku decal skin for Xbox one X Console and 2 Controllers
Goku decal skin for Xbox one X Console and 2 Controllers
$23.00
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i